Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr22140XFF4834R_chr24110978_2562400_r3_XFF4834R-XFF4834R_chr22140XFF4834R_chr22140putative TonB family protein

XFF4834R_chr24110978_2562400_r3_XFF4834R-XFF4834R_chr22140 XFF4834R_chr22140
XFF4834R_chr22130
XFF4834R_chr22130
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr22150
XFF4834R_chr22150
ID XFF4834R_chr24110978_2562400_r3_XFF4834R-XFF4834R_chr22140
AC XFF4834R_chr22140
LT XFF4834R_chr22140
OR XFF4834R_chr from 2561978 to 2562400 on strand -
DE putative TonB family protein
IP TonB, C-terminal
CL 4.2.C.1 TonB Family of Auxiliary Proteins for Energization of OMR-mediated Transport
EC
GO InterPro
Biological Process: protein transport (GO:0015031)
Cellular Component: membrane (GO:0016020)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Molecular Function: protein transporter activity (GO:0008565)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100519)
MW 14494.5 Da
SQ 140 aa
 
........10........20........30........40........50
| | | | |
MNMYRAALAGLIVATGLGGCGKSPQQASAPTVAPTELAALKTPPPEYSPQ
LACAGVGGTTVLRVVVGAQGTPTDVSVAQSSGQPVLDEAAQKRVRQWQFK
AATRNGQAVSQTIQVPVSFKPPVPRPNECFAIEERARRGG
XFF4834R

XFF4834R_chr00080 lcl|XFF4834R_chr00080925_0011593_f2_XFF4834R-XFF4834R_chr00080

33

119

S=127 I=34 E=2.13857e-09

XFF4834R

XFF4834R_chr28560 lcl|XFF4834R_chr31080263_3288925_f2_XFF4834R-XFF4834R_chr28560

41

121

S=123 I=37 E=6.30448e-09

XFF4834R

XFF4834R_chr28570 lcl|XFF4834R_chr31110171_3289749_f1_XFF4834R-XFF4834R_chr28570

45

119

S=115 I=35 E=6.35438e-08

XFF4834R

XFF4834R_chr18580 lcl|XFF4834R_chr19920044_2123721_r1_XFF4834R-XFF4834R_chr18580

36

120

S=114 I=38 E=7.69797e-08

XFF4834R

XFF4834R_chr12880 lcl|XFF4834R_chr_1467687_1468991_f3_XFF4834R-XFF4834R_chr12880

44

120

S=100 I=27 E=3.4159e-06

XFF4834R

XFF4834R_chr00080 lcl|XFF4834R_chr00080925_0011593_f2_XFF4834R-XFF4834R_chr00080

33

119

S=127 I=34 E=2.13857e-09

XFF4834R

XFF4834R_chr28560 lcl|XFF4834R_chr31080263_3288925_f2_XFF4834R-XFF4834R_chr28560

41

121

S=123 I=37 E=6.30448e-09

XFF4834R

XFF4834R_chr28570 lcl|XFF4834R_chr31110171_3289749_f1_XFF4834R-XFF4834R_chr28570

45

119

S=115 I=35 E=6.35438e-08

XFF4834R

XFF4834R_chr18580 lcl|XFF4834R_chr19920044_2123721_r1_XFF4834R-XFF4834R_chr18580

36

120

S=114 I=38 E=7.69797e-08

XFF4834R

XFF4834R_chr12880 lcl|XFF4834R_chr_1467687_1468991_f3_XFF4834R-XFF4834R_chr12880

44

120

S=100 I=27 E=3.4159e-06

X.species

NP_642432.1 lcl|XAC2115-XAC2115

3

140

S=621 I=90 E=1.09776e-68

hypothetical protein

X.species

YP_364158.1 lcl|XCV2427

1

140

S=600 I=84 E=3.87994e-66

putative secreted protein

X.species

NP_637446.1 lcl|XCC2081

1

140

S=518 I=74 E=3.31762e-56

hypothetical protein

X.species

lcl|tonB-XALc_1614

17

140

S=331 I=55 E=1.32579e-33

putative tonb protein

X.species

NP_641984.1 lcl|XAC1652-XAC1652

41

121

S=130 I=37 E=2.97502e-09

hypothetical protein

X.species

NP_635403.1 lcl|tonB-XCC0008

33

119

S=128 I=34 E=5.10802e-09

TonB protein

X.species

YP_361739.1 lcl|tonB1-XCV0008

33

119

S=127 I=34 E=7.62837e-09

energy transducer TonB protein

X.species

NP_640364.1 lcl|tonB-XAC0008

33

119

S=127 I=34 E=7.62837e-09

TonB protein

X.species

YP_363424.1 lcl|tonB3-XCV1693

70

121

S=126 I=46 E=9.73765e-09

TonB-like protein

X.species

lcl|tonB3-XALc_1701

70

121

S=126 I=44 E=1.02606e-08

putative tonb_protein

X.species

lcl|XALc_0008

33

119

S=124 I=34 E=1.97315e-08

putative energy transducer tonb protein

X.species

NP_636964.1 lcl|XCC1593

70

121

S=123 I=46 E=2.04318e-08

hypothetical protein

X.species

YP_363423.1 lcl|tonB2-XCV1692

69

119

S=120 I=45 E=5.66667e-08

TonB-like protein

X.species

NP_641983.1 lcl|XAC1651-XAC1651

69

119

S=118 I=43 E=1.0252e-07

TonB-like protein

X.species

YP_364661.1 lcl|tonB4-XCV2930

36

120

S=116 I=40 E=1.79121e-07

TonB-like protein

X.species

NP_643083.1 lcl|XAC2774-XAC2774

69

120

S=113 I=51 E=3.53585e-07

TonB-like protein

X.species

NP_636963.1 lcl|XCC1592

69

119

S=111 I=43 E=6.56653e-07

TonB-like protein

X.species

NP_637960.1 lcl|tonB-XCC2612

69

120

S=110 I=51 E=8.3822e-07

TonB like protein

X.species

NP_643669.1 lcl|XAC3362-XAC3362

44

120

S=107 I=29 E=2.09383e-06

TonB-like protein

X.species

YP_365210.1 lcl|blaR1-XCV3479

44

120

S=103 I=27 E=6.28117e-06

putative BlaR1 antirepressor (fragment)

pubmed

33

119

S=128 I=34 E=1.54333e-07

TonB

Pubmed 12646254

 

prodomImg

pubmed

33

119

S=128 I=34 E=1.54333e-07

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

40

120

S=119 I=37 E=2.34341e-06

Protein tonB2 ; Cell inner membrane transport Transmembrane

Pubmed 10689178

 

prodomImg

pubmed

69

120

S=114 I=44 E=9.29214e-06

TonB

Pubmed 11292789

 

prodomImg

sp

33

119

S=128 I=34 E=1.08684e-07

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

 

prodomImg

sp

33

119

S=128 I=34 E=1.08684e-07

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

 

prodomImg

sp

40

120

S=119 I=37 E=1.65027e-06

Protein tonB2 ; Cell inner membrane transport Transmembrane

 

prodomImg

Iprscan IPR006260 [PF03544]

43

120

TonB, C-terminal

Iprscan IPR006260 [TIGR01352]

45

122

TonB, C-terminal

Iprscan [PS51257]

1

20

-

Iprscan [seg]

55

67

-

Iprscan [SignalP-NN(euk)]

1

21

-

PDA1L178

20

74

S=156 I=62 E=1.84413e-11

PD918058

75

120

S=133 I=57 E=1.30927e-08

Iprscan [SSF74653]

40

122

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one HqLBuDKf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAfihJ9/XFF4834R_chr22140.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAfihJ9/XFF4834R_chr22140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAfihJ9/XFF4834R_chr22140.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAfihJ9/XFF4834R_chr22140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.