Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr21790XFF4834R_chr23760078_2527248_f1_acur-XFF4834R_chr21790XFF4834R_chr21790conserved hypothetical protein

XFF4834R_chr23760078_2527248_f1_acur-XFF4834R_chr21790 XFF4834R_chr21790
XFF4834R_chr21780
XFF4834R_chr21780
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21800
XFF4834R_chr21800
ID XFF4834R_chr23760078_2527248_f1_acur-XFF4834R_chr21790
AC XFF4834R_chr21790
LT XFF4834R_chr21790
OR XFF4834R_chr from 2527078 to 2527248 on strand +
DE conserved hypothetical protein
IP Protein of unknown function DUF1674
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by darrasse (20120308)
MW 6256.9 Da
SQ 56 aa
 
........10........20........30........40........50
| | | | |
MIGHPTPTPAQDSETQPSSQEHIPEKKPLPKEIGGRDGPEPTRYGDWEKN
GRCIDF
Show or not Domain decomposition
 
X.species

NP_642395.2 lcl|XAC2073-XAC2073

1

56

S=298 I=100 E=4.71749e-30

hypothetical protein

X.species

NP_637494.1 lcl|XCC2134

1

56

S=288 I=98 E=7.16308e-29

hypothetical protein

X.species

YP_363971.1 lcl|XCV2240

1

56

S=285 I=98 E=1.6399e-28

hypothetical protein

X.species

lcl|XALc_1827

1

56

S=167 I=68 E=3.71072e-14

conserved hypothetical protein

Iprscan IPR012875 [PF07896]

19

56

Protein of unknown function DUF1674

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6SIo0ssO)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8iz5MA/XFF4834R_chr21790.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8iz5MA/XFF4834R_chr21790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8iz5MA/XFF4834R_chr21790.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8iz5MA/XFF4834R_chr21790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.