Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr21590XFF4834R_chr23530104_2506487_r2_XFF4834R-XFF4834R_chr21590XFF4834R_chr21590putative hybrid sensory histine kinase / regulatory protein

XFF4834R_chr23530104_2506487_r2_XFF4834R-XFF4834R_chr21590 XFF4834R_chr21590
XFF4834R_chr_2306
XFF4834R_chr_2306
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21600
XFF4834R_chr21600
ID XFF4834R_chr23530104_2506487_r2_XFF4834R-XFF4834R_chr21590
AC XFF4834R_chr21590
LT XFF4834R_chr21590
OR XFF4834R_chr from 2503104 to 2506487 on strand -
DE putative hybrid sensory histine kinase / regulatory protein
IP PAS; TPP-binding enzymes, conserved site; PAS-associated, C-terminal; GAF; Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region; Signal transduction histidine kinase, hybrid-type, BC3207, predicted
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Biological Process: signal transduction (GO:0007165)
Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
Cellular Component: membrane (GO:0016020)
DNA-dependent (GO:0006355)
Molecular Function: magnesium ion binding (GO:0000287)
Molecular Function: protein histidine kinase activity (GO:0004673)
Molecular Function: signal transducer activity (GO:0004871)
Molecular Function: two-component response regulator activity (GO:0000156)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: thiamin pyrophosphate binding (GO:0030976)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: transferase activity (GO:0016740)

Curated
PM
AN
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101013)
MW 123321.2 Da
SQ 1127 aa
 
........10........20........30........40........50
| | | | |
MDIAVSPLAGLLPETSETAALLAASVHPADALLSDSPALRTALSICLHGQ
VPMLLVWGRDNRCIYNDACIALLGPRHPAAFGQPLAALTYASDGDGEPAA
TIALDLASWSCSPVLQSGEQLGALYIGVAISTTDVSEQRRSDGRDSFLLM
LEDALQYVSDPRQIIDTSVRLLGEHLQANRCAFGLVAADGSTMHVISDHV
QDMPSLQGDFPLEAARGLRDALLENRPWFTTDALAPGAPDYVAEQYRRSG
LRASLAIPLHKHDRLVAAIGVHQRAPRRWLSAEIELVRLVVARCWESMQR
AKAQQQLAANEARLRRLANTLPQIIFIADPDGRPHYFNQRWYEYTGLDPS
NNEDAAWHLAHTADGLRLSEQAWSLALKGERALEVECELLRHDGQSRWHL
VRALPVRGDEGSISEWIGTYTDIHDRRAFEQQLRESEVRFRALCETVPAM
IWMADAQGDCVYWNPRWYDFTGQGEDQALDQGWWDVMHPEDAARVRHAFE
QALDQRGEFLAEYRVRRHDGQYRWCIDTASPHFASDGRFLGHIGSLTDIS
ERKHIEDATASDRAILSLITTGAPLPAVLDAIALSVEARGEIPLYCSVMV
RDEVRHTLSFGSAPHFPIEYRGHFEPSPIGPEGPPCALSAHLGRQVICTD
IQADASFSAHHAISAAMGIAACCVTPILASNGQVLGTLNIYYDRPHLPSL
REQAMARSASHLAGIVIERTRVDAKLKLSLQAETAARAQAEHANRVKDEF
LATLSHELRTPLNAILGWSRLMQSDIADPANLGRGLVIIERSARAQTQII
DDLLDMSAILSGKIRLQAEHFDIAGLVRSALELMQPTALTRKIALELDAP
CDGELWFFGDAGRLQQVLTNLLSNALKFTPAGGTVRVAMDVEDERLRLCV
QDTGIGIAAEFLPHVFDRFRQADAGTTRRVGGLGLGLSISRQLVDLHGGS
LGASSAGEGHGALFTIVLPFQHGVSDLRPASADTPHVGALPDECRDRLAG
ARVLLVDDDQDSREAVMQFLMLAGAQVQAAGSVDAAEHCLANAHFDVLVS
DIAMPVRDGYDLIRTVRSGRADLPRHIPAVALTAYVREEDRDRAVVAGFD
AHMGKPVEPPGLVDLIERLILPTRSTR
XFF4834R

XFF4834R_chr35800 lcl|XFF4834R_chr39000203_4152314_r2_XFF4834R-XFF4834R_chr35800

745

1116

S=637 I=42 E=4.40104e-70

XFF4834R

XFF4834R_chr35800 lcl|XFF4834R_chr39000203_4152314_r2_XFF4834R-XFF4834R_chr35800

396

556

S=265 I=35 E=5.70132e-25

XFF4834R

XFF4834R_chr35800 lcl|XFF4834R_chr39000203_4152314_r2_XFF4834R-XFF4834R_chr35800

321

447

S=127 I=29 E=2.97437e-08

XFF4834R

XFF4834R_chr20180 lcl|XFF4834R_chr21680335_2316515_f3_XFF4834R-XFF4834R_chr20180

744

1125

S=431 I=32 E=4.42433e-45

XFF4834R

XFF4834R_chr24780 lcl|XFF4834R_chr27100302_2863396_f2_XFF4834R-XFF4834R_chr24780

744

1120

S=376 I=33 E=2.11467e-38

XFF4834R

XFF4834R_chr24780 lcl|XFF4834R_chr27100302_2863396_f2_XFF4834R-XFF4834R_chr24780

989

1122

S=139 I=33 E=1.01863e-09

XFF4834R

XFF4834R_chr16090 lcl|XFF4834R_chr17300019_1859594_f3_XFF4834R-XFF4834R_chr16090

747

1120

S=328 I=32 E=1.1732e-32

XFF4834R

XFF4834R_chr09040 lcl|XFF4834R_chr09630140_1044050_r2_XFF4834R-XFF4834R_chr09040

744

1120

S=304 I=31 E=1.04486e-29

XFF4834R

XFF4834R_chr16120 lcl|XFF4834R_chr17370806_1868315_f3_XFF4834R-XFF4834R_chr16120

747

1116

S=300 I=31 E=2.94885e-29

XFF4834R

XFF4834R_chr16110 lcl|XFF4834R_chr17340755_1864378_f2_XFF4834R-XFF4834R_chr16110

747

1116

S=295 I=31 E=1.11941e-28

X.species

NP_642380.1 lcl|XAC2054-XAC2054

1

1127

S=5369 I=91 E=0

two-component system sensor protein

X.species

YP_363946.1 lcl|XCV2215

1

1125

S=5257 I=90 E=0

two-component system sensor histidine kinase-response regulator hybrid protein

X.species

NP_637509.1 lcl|XCC2153

1

1127

S=4131 I=72 E=0

two-component system sensor protein

X.species

lcl|XALc_1635

128

1122

S=2193 I=47 E=0

putative two-component system sensor protein

X.species

lcl|XALc_1635

6

84

S=166 I=51 E=1.93192e-12

putative two-component system sensor protein

X.species

NP_643990.1 lcl|XAC3683-XAC3683

745

1116

S=643 I=42 E=3.13581e-70

sensor histidine kinase

X.species

NP_643990.1 lcl|XAC3683-XAC3683

396

556

S=264 I=35 E=2.42663e-24

sensor histidine kinase

X.species

NP_643990.1 lcl|XAC3683-XAC3683

321

447

S=125 I=29 E=1.8742e-07

sensor histidine kinase

X.species

lcl|XALc_2929

745

1116

S=639 I=42 E=9.57243e-70

putative two-component system sensor-response regulator hybrid protein

X.species

lcl|XALc_2929

395

556

S=266 I=39 E=1.5692e-24

putative two-component system sensor-response regulator hybrid protein

pubmed

432

1119

S=597 I=31 E=4.96102e-63

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17564599

 

prodomImg

pubmed

132

302

S=210 I=34 E=3.39509e-16

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17564599

 

prodomImg

pubmed

320

443

S=173 I=35 E=1.08841e-11

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17564599

 

prodomImg

pubmed

744

1119

S=454 I=36 E=1.11976e-45

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 18555551

 

prodomImg

pubmed

744

1119

S=442 I=35 E=2.60647e-44

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 8075420

 

prodomImg

pubmed

744

1124

S=416 I=32 E=4.12713e-41

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 8810082

 

prodomImg

pubmed

744

1124

S=403 I=31 E=1.4856e-39

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 11123673

 

prodomImg

pubmed

744

1124

S=402 I=31 E=2.18026e-39

Sensory/regulatory protein rpfC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transcription regulation

Pubmed 1645442

 

prodomImg

pubmed

744

1118

S=396 I=30 E=1.16283e-38

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 19182778

 

prodomImg

pubmed

391

1075

S=394 I=27 E=2.08551e-38

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 12855730

 

prodomImg

Iprscan [coil]

300

321

-

Iprscan [G3DSA:3.30.450.20]

297

424

-

Iprscan [G3DSA:3.30.450.20]

425

550

-

Iprscan [G3DSA:3.30.450.40]

595

727

-

Iprscan IPR003594 [G3DSA:3.30.565.10]

817

971

ATP-binding region, ATPase-like

Iprscan [G3DSA:3.40.50.2300]

994

1120

-

Iprscan IPR003018 [PF01590]

160

298

GAF

Iprscan IPR013656 [PF08448]

318

428

PAS fold-4

Iprscan IPR013655 [PF08447]

460

546

PAS fold-3

Iprscan IPR003018 [PF01590]

595

717

GAF

Iprscan IPR003661 [PF00512]

746

812

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [PF02518]

859

971

ATP-binding region, ATPase-like

Iprscan IPR001789 [PF00072]

1003

1117

Signal transduction response regulator, receiver region

Iprscan IPR003018 [SM00065]

160

308

GAF

Iprscan IPR000014 [SM00091]

312

378

PAS

Iprscan IPR001610 [SM00086]

384

426

PAC motif

Iprscan IPR000014 [SM00091]

438

504

PAS

Iprscan IPR001610 [SM00086]

510

552

PAC motif

Iprscan IPR003018 [SM00065]

570

727

GAF

Iprscan IPR003661 [SM00388]

746

812

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [SM00387]

859

972

ATP-binding region, ATPase-like

Iprscan IPR001789 [SM00448]

1001

1116

Signal transduction response regulator, receiver region

Iprscan IPR000014 [TIGR00229]

308

433

PAS

Iprscan IPR000014 [TIGR00229]

434

559

PAS

Iprscan IPR000399 [PS00187]

843

862

TPP-binding enzymes, conserved site

Iprscan IPR005467 [PS50109]

753

972

Signal transduction histidine kinase, core

Iprscan IPR001789 [PS50110]

1002

1120

Signal transduction response regulator, receiver region

Iprscan IPR000014 [PS50112]

310

351

PAS

Iprscan IPR000014 [PS50112]

436

506

PAS

Iprscan IPR000700 [PS50113]

383

435

PAS-associated, C-terminal

Iprscan IPR000700 [PS50113]

509

561

PAS-associated, C-terminal

Iprscan [seg]

303

319

-

Iprscan [seg]

653

666

-

Iprscan [seg]

731

743

-

Iprscan [seg]

931

937

-

Iprscan [seg]

946

963

-

PD653774

1

245

S=867 I=70 E=2.58012e-97

PD576747

596

699

S=182 I=39 E=2.8164e-14

PDA1T4S2

555

594

S=182 I=98 E=2.96766e-14

PDA2Y2B5

868

899

S=164 I=97 E=4.05511e-12

PD929964

972

1000

S=144 I=97 E=1.17282e-09

PDA8G9J5

398

558

S=138 I=24 E=5.34666e-09

PDA1U238

428

454

S=136 I=96 E=1.00164e-08

PD307312

748

889

S=135 I=29 E=1.49586e-08

PD765093

384

454

S=134 I=38 E=1.92619e-08

PD945386

430

517

S=134 I=28 E=1.97724e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one DX1DyGSF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

291 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

58 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

36 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuBBS5w/XFF4834R_chr21590.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuBBS5w/XFF4834R_chr21590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuBBS5w/XFF4834R_chr21590.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuBBS5w/XFF4834R_chr21590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.