Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr21470ppsAXFF4834R_chr21470phosphoenolpyruvate synthase, probable

ppsA XFF4834R_chr21470
XFF4834R_chr21460
XFF4834R_chr21460
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21480
XFF4834R_chr21480
ID ppsA
AC XFF4834R_chr21470
LT XFF4834R_chr21470
OR XFF4834R_chr from 2488941 to 2491319 on strand -
DE phosphoenolpyruvate synthase, probable
IP Phosphoenolpyruvate synthase; Pyruvate/Phosphoenolpyruvate kinase, catalytic core
CL 1.1.1 Carbohydrates/Carbon compounds GO:0016052
EC
GO InterPro
Biological Process: phosphorylation (GO:0016310)
Biological Process: gluconeogenesis (GO:0006094)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: kinase activity (GO:0016301)
transferring phosphorus-containing groups (GO:0016772)
water dikinase activity (GO:0008986)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110111)
MW 85949.1 Da
SQ 792 aa
 
........10........20........30........40........50
| | | | |
MNENILWLHELRLADLARVGGKNSSLGEMIGNLAGLGVSVPGGYATTAEA
FKDFIAHNDLSKRIFDKLATLDVEDVNALTLAGKEIRGWVIDAPLQPELD
RDIRSAYAQLCAENGGGQVAVAVRSSATAEDLPDASFAGQQETFLNVTGA
DDVVHKVKEVFASLYNDRAIAYRVHHGFKHEDVFLSAGVQLMVRSGVGAA
GVLFTLDTESGFRDVVFVTSSFGLGEMVVQGAVNPDEFYVYKPTLTAGKP
AILRRSLGSKAIRMVYSDVPGERVRTEDTPVELRSTFSISDEDVQELSKQ
ALVIEKHYGRPMDIEWAKDGVSGKLFIVQARPETVKSRSHATQIERFALE
AKDAKILAEGRAVGAKIGSGVARVVRSLDDMNRVQAGDVLIADMTDPDWE
PVMKRASAIVTNRGGRTCHAAIIARELGVPAVVGSGNATDVLSDGQEVTV
SCAEGDTGFIYEGLLPFERTTTDLGNMPPAPLKIMMNVANPERAFDFGQL
PNAGIGLARLEMIIAAHIGIHPNALLEYDKQDADVRKKIDAKIAGYGDPV
SFYVNRLAEGIATLTASVAPNTVIVRLSDFKSNEYANLIGGSRYEPHEEN
PMIGFRGASRYVDPSFTKAFALECKAVLKVRNEMGLDNLWVMIPFVRTLE
EGRKVIEVLEQNGLKQGENGLKIIMMCELPSNALLADEFLEIFDGFSIGS
NDLTQLTLGLDRDSSIVAHLFDERNPAVKKLLSMAIKSARAKGKYVGICG
QGPSDHPELAEWLMQEGIESVSLNPDTVVDTWLRLAKLKSEG
XFF4834R

XFF4834R_chr16590 lcl|ptsI-XFF4834R_chr16590

386

781

S=244 I=27 E=1.12581e-22

PEP-protein phosphotransferase of PTS system (enzyme I)

XFF4834R

XFF4834R_chr24970 lcl|XFF4834R_chr27350581_2889097_f2_XFF4834R-XFF4834R_chr24970

596

785

S=191 I=29 E=3.05306e-16

X.species

NP_642367.1 lcl|ppsA-XAC2041

1

792

S=4161 I=99 E=0

phosphoenolpyruvate synthase

X.species

YP_363933.1 lcl|ppsA-XCV2202

1

792

S=4144 I=99 E=0

phosphoenolpyruvate synthase

X.species

NP_637522.1 lcl|ppsA-XCC2166

1

792

S=4126 I=98 E=0

phosphoenolpyruvate synthase

X.species

lcl|ppsA-XALc_1645

1

792

S=3764 I=88 E=0

probable phosphoenolpyruvate synthase protein

X.species

NP_643288.1 lcl|ptsI-XAC2979

386

781

S=242 I=27 E=9.01608e-22

phosphotransferase system enzyme I

X.species

NP_638157.1 lcl|ptsI-XCC2809

386

781

S=239 I=27 E=1.77978e-21

phosphotransferase system enzyme I

X.species

YP_364856.1 lcl|ptsI-XCV3125

386

781

S=239 I=27 E=1.95892e-21

enzyme I of the phosphotransferase system

X.species

NP_637724.1 lcl|fruB-XCC2370

596

785

S=204 I=31 E=3.62583e-17

multiphosphoryl transfer protein

X.species

lcl|XALc_2146

597

781

S=203 I=28 E=4.5089e-17

putative phosphotransferase system (pts), enzymeIprotein

X.species

NP_642816.1 lcl|fruB-XAC2501

596

785

S=185 I=29 E=6.90055e-15

multiphosphoryl transfer protein

X.species

YP_364410.1 lcl|fruB-XCV2679

596

785

S=183 I=29 E=1.04866e-14

multiphosphoryl transfer protein FruB

pubmed

1

792

S=4126 I=98 E=0

Phosphoenolpyruvate synthase ; Kinase Magnesium Metal-binding Transferase

Pubmed 16109965

 

prodomImg

pubmed

5

786

S=2819 I=66 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 17038831

 

prodomImg

pubmed

5

789

S=2779 I=65 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 1310524

 

prodomImg

pubmed

1

781

S=2064 I=50 E=0

Putative phosphoenolpyruvate synthase

Pubmed 17351032

 

prodomImg

pubmed

5

781

S=1585 I=44 E=0

Probable phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 7805870

 

prodomImg

sp

5

786

S=2819 I=66 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

 

prodomImg

sp

5

789

S=2779 I=65 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

 

prodomImg

sp

11

786

S=2597 I=65 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

 

prodomImg

sp

5

789

S=2288 I=55 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

 

prodomImg

sp

5

791

S=2247 I=52 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

 

prodomImg

Iprscan IPR006318 [PR01736]

694

709

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

711

726

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

747

759

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR013815 [G3DSA:3.30.1490.20]

2

193

ATP-grasp fold, subdomain 1

Iprscan IPR008279 [G3DSA:3.50.30.10]

348

462

PEP-utilising enzyme, mobile domain

Iprscan IPR015813 [G3DSA:3.20.20.60]

480

789

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan [PTHR22931:SF7]

8

784

-

Iprscan [PTHR22931]

8

784

-

Iprscan IPR002192 [PF01326]

16

345

Pyruvate phosphate dikinase, PEP/pyruvate-binding

Iprscan IPR000121 [PF02896]

482

788

PEP-utilising enzyme

Iprscan IPR008279 [PF00391]

381

455

PEP-utilising enzyme, mobile domain

Iprscan IPR006319 [TIGR01418]

4

790

Phosphoenolpyruvate synthase

Iprscan IPR018274 [PS00370]

414

425

PEP-utilising enzyme, mobile region, conserved site

Iprscan IPR000121 [PS00742]

694

712

PEP-utilising enzyme

PD001289

98

255

S=346 I=45 E=3.71683e-34

PDA1E8C3

477

574

S=325 I=63 E=1.0564e-31

PD003552

352

463

S=291 I=53 E=1.58615e-27

PD283462

258

338

S=222 I=56 E=3.60711e-19

PD156495

156

211

S=222 I=73 E=3.80083e-19

PD000940

595

788

S=221 I=35 E=4.0754e-19

PD121751

575

627

S=177 I=66 E=9.70527e-14

PD483258

117

158

S=168 I=76 E=1.25962e-12

PD708813

214

331

S=163 I=31 E=5.30901e-12

PD860808

658

712

S=159 I=58 E=1.66359e-11

Iprscan [SSF56059]

1

386

-

Iprscan IPR015813 [SSF51621]

461

791

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

344

467

PEP-utilising enzyme, mobile domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0pYdgZbp)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

165 hits
swiss-prot

Swiss-Prot ncbi-blastp

111 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1EbiPT/XFF4834R_chr21470.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1EbiPT/XFF4834R_chr21470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1EbiPT/XFF4834R_chr21470.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1EbiPT/XFF4834R_chr21470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.