Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20940XFF4834R_chr_2423222_2424943_r3_XFF4834R-XFF4834R_chr20940XFF4834R_chr20940putative regulatory protein of a two component system

XFF4834R_chr_2423222_2424943_r3_XFF4834R-XFF4834R_chr20940 XFF4834R_chr20940
XFF4834R_chr20930
XFF4834R_chr20930
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20950
XFF4834R_chr20950
ID XFF4834R_chr_2423222_2424943_r3_XFF4834R-XFF4834R_chr20940
AC XFF4834R_chr20940
LT XFF4834R_chr20940
OR XFF4834R_chr from 2423222 to 2424943 on strand -
DE putative regulatory protein of a two component system
IP Diguanylate cyclase, predicted; Cyclic nucleotide-binding; Diguanylate phosphodiesterase, predicted; Signal transduction response regulator, receiver region
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
DNA-dependent (GO:0006355)
Molecular Function: two-component response regulator activity (GO:0000156)

Curated
PM
AN predicted diguanylate cyclase. May be involved in regulation of bacterial cell surface adhesiveness (combination EAL and GGDEF domains)
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101013)
MW 64006.3 Da
SQ 573 aa
 
........10........20........30........40........50
| | | | |
MWSPVIPPGLEIVKPTRLGAGNPELLHLVDAAASGGPPLMIFHVDIDHFA
SINENMSGEVGDQALTLAARRLQEFLGTRGKLWRHGSDEMVVVAVRREDT
PLPEDFAEEIRQQLELPLSVLPYTLFMTGKVGISLCPEHSTSLSTLLDYA
EEASYQAAREGGNTVRLYTRNSATNAHSESIIARQIVDAIPHGELRLRYQ
PLVSARDGRIVGMEALLRWQSPTLGMLVPERFMRTAERLGVIVQIGEWVL
QNAVRQARLWRDQGFDDFSIAVNVSTLQLLRPGFFNEVMAMLQTAGVPAQ
FVTLEINESALTNNVNFVHETMANLRNEGISLSLDNFGTGDSSLSALVRY
PVDRLKIDRSFIKSAPAGSREAAIARAIIAMGHQLGMTVIANGVESQAQL
GFLRRNDCDIFQGYLFGEPMSAESAGMALRRRYLRPESFAESRPDRTLLL
LDDEENVLRSLVRLFRRDGYRILAAGNVRDAFDLLATNDVQVILSDQRMS
DMSGTEFLGRVKMLYPDTVRLVLSGYTDLATVTEAINRGAIYRFLTKPWN
DDELREHIRQAFRTHDELRNGRE
XFF4834R

XFF4834R_chr27070 lcl|XFF4834R_chr_3119625_3121982_r2_XFF4834R-XFF4834R_chr27070

28

420

S=571 I=36 E=2.3717e-62

XFF4834R

XFF4834R_chr23930 lcl|XFF4834R_chr_2758898_2761015_r3_XFF4834R-XFF4834R_chr23930

27

421

S=568 I=35 E=4.2536e-62

XFF4834R

XFF4834R_chr20960 lcl|XFF4834R_chr22760224_2429986_f2_XFF4834R-XFF4834R_chr20960

36

430

S=540 I=35 E=1.19746e-58

XFF4834R

XFF4834R_chr20280 lcl|dos-XFF4834R_chr20280

28

424

S=519 I=33 E=4.30679e-56

cAMP phosphodiesterase, heme-regulated

XFF4834R

XFF4834R_chr19240 lcl|XFF4834R_chr20630458_2204527_r3_XFF4834R-XFF4834R_chr19240

194

424

S=427 I=39 E=5.64069e-45

XFF4834R

XFF4834R_chr17650 lcl|XFF4834R_chr18800052_2017335_r1_XFF4834R-XFF4834R_chr17650

189

420

S=386 I=38 E=5.42466e-40

XFF4834R

XFF4834R_chr22680 lcl|XFF4834R_chr24740622_2628433_f2_XFF4834R-XFF4834R_chr22680

183

423

S=355 I=33 E=3.09447e-36

XFF4834R

XFF4834R_chr38250 lcl|XFF4834R_chr41350189_4420751_f3_XFF4834R-XFF4834R_chr38250

189

422

S=316 I=36 E=1.79477e-31

conserved inner membrane protein

XFF4834R

XFF4834R_chr18160 lcl|XFF4834R_chr19380119_2077524_f1_XFF4834R-XFF4834R_chr18160

25

423

S=270 I=26 E=5.64955e-26

XFF4834R

XFF4834R_chr24090 lcl|XFF4834R_chr26280556_2778625_f2_XFF4834R-XFF4834R_chr24090

106

359

S=170 I=25 E=7.52321e-14

X.species

YP_363770.1 lcl|XCV2039

1

573

S=2966 I=98 E=0

putative two-component system sensor-response regulator hybrid protein

X.species

NP_637323.1 lcl|pdeA-XCC1958

1

573

S=2956 I=98 E=0

c-di-GMP phosphodiesterase A

X.species

NP_642318.1 lcl|XAC1992-XAC1992

1

573

S=2950 I=98 E=0

c-di-GMP phosphodiesterase A

X.species

lcl|XALc_1434

1

569

S=2461 I=82 E=0

putative two-component system sensor-response regulator hybrid protein

X.species

lcl|XALc_0992

24

420

S=645 I=37 E=8.31182e-71

conserved hypothetical protein

X.species

NP_642264.1 lcl|XAC1938-XAC1938

22

423

S=602 I=35 E=1.45883e-65

GGDEF family protein

X.species

YP_363713.1 lcl|XCV1982

22

423

S=602 I=35 E=1.49749e-65

putative sensor protein

X.species

lcl|XALc_0787

28

435

S=601 I=35 E=1.66266e-65

hypothetical two-component system sensor protein

X.species

NP_637276.1 lcl|XCC1911

36

420

S=591 I=36 E=3.45547e-64

GGDEF family protein

X.species

NP_637884.2 lcl|XCC2536

24

420

S=589 I=35 E=4.98356e-64

phosphodiesterase

pubmed

420

573

S=769 I=98 E=3.06664e-84

Genes for sensor and regulator protein

Pubmed 2233675

 

prodomImg

pubmed

33

431

S=689 I=38 E=1.68094e-74

PA5017-like protein

Pubmed 17521365

 

prodomImg

pubmed

29

422

S=616 I=34 E=1.11715e-65

MorA

Pubmed 15489433

 

prodomImg

pubmed

40

423

S=576 I=33 E=8.05742e-61

Signaling protein ykoW ; Cell membrane Transmembrane

Pubmed 11728710

 

prodomImg

pubmed

35

423

S=574 I=34 E=1.38344e-60

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

32

431

S=573 I=34 E=1.8771e-60

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

28

432

S=570 I=30 E=4.37298e-60

YkoW protein

Pubmed 10589720

 

prodomImg

pubmed

15

423

S=569 I=31 E=5.16085e-60

ScrC

Pubmed 12374828

 

prodomImg

pubmed

32

431

S=569 I=34 E=5.98539e-60

PDEA1

Pubmed 15042328

 

prodomImg

pubmed

35

420

S=556 I=34 E=2.1545e-58

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

Iprscan [G3DSA:3.30.70.270]

25

176

-

Iprscan [G3DSA:3.40.50.2300]

443

570

-

Iprscan IPR000160 [PF00990]

24

164

Diguanylate cyclase, predicted

Iprscan IPR001633 [PF00563]

184

419

Diguanylate phosphodiesterase, predicted

Iprscan IPR001789 [PF00072]

448

559

Signal transduction response regulator, receiver region

Iprscan IPR000160 [SM00267]

11

168

Diguanylate cyclase, predicted

Iprscan IPR001633 [SM00052]

178

424

Diguanylate phosphodiesterase, predicted

Iprscan IPR001789 [SM00448]

446

558

Signal transduction response regulator, receiver region

Iprscan IPR000160 [TIGR00254]

10

169

Diguanylate cyclase, predicted

Iprscan IPR000595 [PS50042]

465

520

Cyclic nucleotide-binding

Iprscan IPR001789 [PS50110]

447

562

Signal transduction response regulator, receiver region

Iprscan IPR001633 [PS50883]

179

433

Diguanylate phosphodiesterase, predicted

Iprscan IPR000160 [PS50887]

37

170

Diguanylate cyclase, predicted

Iprscan [seg]

372

380

-

PDA1T0F3

73

188

S=611 I=99 E=1.96149e-66

PDA8O6T2

408

573

S=313 I=43 E=2.32606e-30

PDA1U5Y7

283

331

S=252 I=100 E=6.19379e-23

PDA1S566

406

446

S=221 I=100 E=3.07316e-19

PDA3D566

235

423

S=190 I=27 E=1.94642e-15

PD240487

448

573

S=158 I=29 E=1.53303e-11

PDA3A8Q6

284

443

S=145 I=28 E=4.71679e-10

PD900627

1

26

S=144 I=100 E=6.51249e-10

PDA266O3

245

371

S=142 I=23 E=1.17823e-09

PDA4S2H4

326

444

S=127 I=28 E=7.7402e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one WcDVAU6U)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

206 hits
swiss-prot

Swiss-Prot ncbi-blastp

90 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

23 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBycsUlz/XFF4834R_chr20940.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBycsUlz/XFF4834R_chr20940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBycsUlz/XFF4834R_chr20940.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBycsUlz/XFF4834R_chr20940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.