Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20870XFF4834R_chr22680163_2418852_r1_XFF4834R-XFF4834R_chr20870XFF4834R_chr20870putative polysaccharide pyruvyl transferase superfamily protein

XFF4834R_chr22680163_2418852_r1_XFF4834R-XFF4834R_chr20870 XFF4834R_chr20870
XFF4834R_chr20860
XFF4834R_chr20860
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20890
XFF4834R_chr20890
ID XFF4834R_chr22680163_2418852_r1_XFF4834R-XFF4834R_chr20870
AC XFF4834R_chr20870
LT XFF4834R_chr20870
OR XFF4834R_chr from 2418163 to 2418852 on strand -
DE putative polysaccharide pyruvyl transferase superfamily protein
IP
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro


Curated
PM
AN predicted with ACUR Using blastp this accession has an ortholog in aurantifolii and a polysaccharide pyruvyl transferase domain
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110712)
MW 26408.8 Da
SQ 229 aa
 
........10........20........30........40........50
| | | | |
MLYLEKALPSTSNITAQPFNLNEIPTFFQLLAKAMAGRLEFFSDYRQWTE
FFKSNDHCLTIGTRLHSGILSINSGVPAIVTNPDSRARETCEYLRIPYDP
TIHSRSNIREVFENLDLSEMNNAYPALHKEFLDFLHAVGLMPCTASYDMP
CFEFPNLKKSTSSSVAAELHEAYTELVENLDRELVVRREHGGEISRRLVN
KFQLLRRRYPGLTRKQYLDYLSRFSGEAK
pubmed

39

140

S=123 I=29 E=1.72601e-06

ExpA5 Putative membrane-anchored protein WgaE (Formerly ExpA5) ; Plasmid

Pubmed 9023225

 

prodomImg

PDA9J9P3

50

98

S=124 I=49 E=1.33982e-07

PD677131

41

98

S=123 I=38 E=2.14544e-07

PD042208

17

88

S=110 I=36 E=6.37481e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one PTjANwCq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB44n3Rt/XFF4834R_chr20870.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB44n3Rt/XFF4834R_chr20870.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB44n3Rt/XFF4834R_chr20870.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB44n3Rt/XFF4834R_chr20870.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.