Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20860XFF4834R_chr22640642_2418166_r3_XFF4834R-XFF4834R_chr20860XFF4834R_chr20860putative flagellar glycosyl transferase

XFF4834R_chr22640642_2418166_r3_XFF4834R-XFF4834R_chr20860 XFF4834R_chr20860
XFF4834R_chr20850
XFF4834R_chr20850
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20870
XFF4834R_chr20870
ID XFF4834R_chr22640642_2418166_r3_XFF4834R-XFF4834R_chr20860
AC XFF4834R_chr20860
LT XFF4834R_chr20860
OR XFF4834R_chr from 2414642 to 2418166 on strand -
DE putative flagellar glycosyl transferase
IP Glycosyl transferase, family 2
CL 6.4 Flagellum GO:0019861
EC
GO InterPro


Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110228)
MW 128618.7 Da
SQ 1174 aa
 
........10........20........30........40........50
| | | | |
MTPNLVSIVMPTYKPRYFAQALESVLAQTYPALELVICDDDADGAIEAAL
ASRLTGAPFPIRYHRNTPRLGELVSTIKGIGLAQGEYIKFLHDDDVLQHD
CIAQLVEAIERNPGTAMASSRRVRIDDDGQPLPDILATCFPFADDVLIDG
PELVSFLADHTINFIGEPSCVLARRADLLALGNELMALNGKAIHWVGDLA
IYVKLLRHGNLAMLASPLTQFRISSAQFSQGGRDQPGIGDQGHEDLRQGI
RQLGWRRETGDNRQVRVAPLSPHKARVFKPVDLVNALMQSAGMAERVSPT
TWLGVRHPSTVQRALIQERLRAHSGGPRIAVLLVDRHGDAAAVAATGDSL
DAVACYQRHRAWVISSSPQQVAAHGERGVLIGAYGLAATLNRVIAAQDAI
DWVLLVDAGTLFTASGLMMLALEMLALPDDCQAVYADEVMALDNGQLGLA
LRPALYLDMLLSAPATLSRHWAFRHRTLLADGGFPTGPSAAFELDYQLGL
IERYGLACIRHMAEPILIASATPQHDDEDERRAIARHLAERGYVDAVVHS
AGPGRHAVDYRHAQQPLVSILVLVDGRLPQVQRCLESILAKTSYPHYEVL
LLDRGTTEADLHGWLSGIENLGMQQIRVLRFAAEPPREAVCNAAVEYARG
EVLLWLAAGAAVMKADWLEQLLNHALRPEVGAVAGKLLRGDGTVHHAGLL
LGLGAPAARAFEGAAFDESGYLQRLQLDQNYSALSGECLMLPRQLFVDAG
GFDLEPALAQWSDVDLCLRLQQAGYLNVFAARAQLLIDPPDTTPATALDE
EAMYARWLPMMANDPAYNPGFSLDPGAGFALADPRASWRPLQSWRPLPSV
IALPADIEGCGHYRVIQPLRALREAGIAEGVLFNGYLEISELARQDPDVV
ILQRQVGEARLDAMRRMKALSRAFKVYELDDYLPNLPLKNAHREHMPKDI
LKTVRRGLGMVDRFVVSTPALAEAFAGLHSDIRVAENRLPPHWWEHLPAR
GERQGGKPRVGWAGGASHTGDLELIADVVRELADEVEWVFMGMYPFALRQ
HIHHFQPGVPIDRYPAALAAVDLDLALAPVEQNLFNECKSNLRLLEYGAC
GYPVIASDVRCYQGSLPVTLVKNRYRDWIGAIREHLADPDASAAKGAALR
EAVHRDWMLSGSHLDTWRAAWLPG
XFF4834R

XFF4834R_chr15220 lcl|XFF4834R_chr16320014_1748098_r3_XFF4834R-XFF4834R_chr15220

562

775

S=114 I=24 E=9.59465e-07

XFF4834R

XFF4834R_chr15220 lcl|XFF4834R_chr16320014_1748098_r3_XFF4834R-XFF4834R_chr15220

2

126

S=105 I=27 E=1.34692e-05

XFF4834R

XFF4834R_chr28180 lcl|XFF4834R_chr30730560_3250498_r3_XFF4834R-XFF4834R_chr28180

5

132

S=104 I=26 E=1.85969e-05

X.species

NP_642283.1 lcl|rbfC-XAC1957

5

1174

S=5483 I=90 E=0

O-antigen biosynthesis protein

X.species

YP_363731.1 lcl|XCV2000

10

1173

S=4966 I=83 E=0

putative glycosyltransferase

X.species

lcl|XALc_1398

1

1173

S=2525 I=49 E=0

putative glycosyltransferase protein

X.species

NP_637293.1 lcl|rbfC-XCC1928

6

1173

S=2319 I=44 E=0

O-antigen biosynthesis protein

X.species

NP_643905.1 lcl|rfbC-XAC3598

385

821

S=230 I=27 E=4.01234e-20

truncated O-antigen biosynthesis protein

X.species

NP_643905.1 lcl|rfbC-XAC3598

5

130

S=119 I=29 E=9.82834e-07

truncated O-antigen biosynthesis protein

X.species

YP_363457.1 lcl|XCV1726

5

116

S=139 I=31 E=3.80607e-09

glycosyltransferase

X.species

YP_364973.1 lcl|XCV3242

562

813

S=122 I=23 E=3.90041e-07

glycosyltransferase

X.species

NP_643419.2 lcl|XAC3110-XAC3110

562

796

S=122 I=24 E=4.64345e-07

glycosyltransferase

X.species

NP_638281.2 lcl|XCC2933

562

796

S=122 I=23 E=4.93567e-07

glycosyl transferase

pubmed

1

1173

S=3399 I=58 E=0

Putative uncharacterized protein

Pubmed 15028697

 

prodomImg

pubmed

5

848

S=2327 I=56 E=0

Flagellar glycosyl transferase ; Flagellum

Pubmed 11481492,15090491

 

prodomImg

pubmed

5

1173

S=1602 I=35 E=0

Putative glycosyltransferase

Pubmed 14594840

 

prodomImg

pubmed

457

1170

S=882 I=34 E=1.3037e-97

O-antigen biosynthesis protein RbfC

Pubmed 10388713

 

prodomImg

pubmed

302

832

S=782 I=36 E=1.70606e-85

Putative glycosyltransferase

Pubmed 14594840

 

prodomImg

pubmed

434

824

S=370 I=27 E=1.69437e-35

Putative glycosyl transferase

Pubmed 9712783

 

prodomImg

pubmed

5

243

S=346 I=36 E=1.37102e-32

Putative uncharacterized protein

Pubmed 15073305

 

prodomImg

pubmed

469

823

S=279 I=31 E=1.73846e-24

O-antigen biosynthesis protein rfbC ; Lipopolysaccharide

Pubmed 8626291

 

prodomImg

pubmed

566

785

S=267 I=29 E=4.33895e-23

WsaE

Pubmed 11741945,15316277

 

prodomImg

pubmed

558

786

S=266 I=31 E=5.73525e-23

Putative O-antigen biosynthesis protein

Pubmed 15473911

 

prodomImg

Iprscan [G3DSA:3.90.550.10]

5

231

-

Iprscan [G3DSA:3.90.550.10]

566

775

-

Iprscan IPR001173 [PF00535]

7

182

Glycosyl transferase, family 2

Iprscan IPR001173 [PF00535]

569

750

Glycosyl transferase, family 2

Iprscan [seg]

417

427

-

Iprscan [seg]

697

716

-

Iprscan [seg]

1065

1080

-

Iprscan [seg]

1137

1148

-

PDA1I0A3

316

566

S=590 I=52 E=9.2866e-64

PD910181

954

1114

S=426 I=55 E=7.03086e-44

PD322018

833

937

S=347 I=59 E=2.53599e-34

PDA8G3Y6

5

98

S=326 I=67 E=1.03953e-31

PDA132U9

142

227

S=303 I=65 E=5.43934e-29

PDA1K636

229

327

S=233 I=53 E=2.06903e-20

PD813194

100

141

S=207 I=93 E=2.47853e-17

PDA2E9M9

328

380

S=198 I=87 E=3.41927e-16

PD542618

568

631

S=182 I=50 E=3.07446e-14

PD882805

1115

1173

S=174 I=63 E=2.53573e-13

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9AsWaUNf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

82 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzdCek/XFF4834R_chr20860.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzdCek/XFF4834R_chr20860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzdCek/XFF4834R_chr20860.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzdCek/XFF4834R_chr20860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.