Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20800fliIXFF4834R_chr20800flagellum-specific ATP synthase

fliI XFF4834R_chr20800
XFF4834R_chr20790
XFF4834R_chr20790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20810
XFF4834R_chr20810
ID fliI
AC XFF4834R_chr20800
LT XFF4834R_chr20800
OR XFF4834R_chr from 2408954 to 2410330 on strand -
DE flagellum-specific ATP synthase
IP ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain
CL 1.6.12 Flagella GO:0009296
EC
GO InterPro
Biological Process: ATP synthesis coupled proton transport (GO:0015986)
Biological Process: biosynthetic process (GO:0009058)
Biological Process: protein secretion by the type III secretion system (GO:0030254)
Biological Process: flagellum assembly (GO:0009296)
Cellular Component: cytoplasm (GO:0005737)
Cellular Component: type III protein secretion system complex (GO:0030257)
Molecular Function: ATPase activity (GO:0016887)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: ATP binding (GO:0005524)
catalytic domain (GO:0033178)
catalyzing transmembrane movement of substances (GO:0016820)

Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100423)
MW 48760.2 Da
SQ 458 aa
 
........10........20........30........40........50
| | | | |
MSALFGATPADWLDARNLRLATRLGTLGLEPTAGRTLIREGILRRAVGLT
LEATGCEAPMGATCKVEVDGGWVDAEVVGFAGERTYLMPSAELHGLLPNA
RVVPSRRRGGVEVGEGLLGRVIDSDGTPLDGKGPIRAEGSIGMAGVSINP
LAREPITTSLDVGVRAINAMLPIGRGQRVGLFAGSGVGKSTLLGMMTRFT
SADVIVVGLIGERGREVRDFVETTLGEEGLRRAVVVAAPADRPPLARLHG
AYRATAIAEWFRDQGLNVLLLMDSLTRFAQAQREIGLSVGEPPTTRGYPP
SVFAKLPALVERAGNGAKGRGSITAFYTVLTEGDDPQDPIADAARAILDG
HILLSRRVADSGLYPAIDLESSVSRVVQDIADDTWRLRIRKLKRLLSAYT
ANRDLIAIGAYQRGSDPATDEALARWPEIVEFLGQDVHKASLLSDSLSAL
QQLVEPEN
XFF4834R

XFF4834R_chr04010 lcl|XFF4834R_chr04110344_0451672_f2_XFF4834R-XFF4834R_chr04010

39

435

S=767 I=43 E=2.85079e-86

XFF4834R

XFF4834R_chr35450 lcl|atpD-XFF4834R_chr35450

122

438

S=258 I=27 E=1.3713e-24

F1 sector of membrane-bound ATP synthase, beta subunit

XFF4834R

XFF4834R_chr35470 lcl|atpA-XFF4834R_chr35470

122

438

S=242 I=26 E=1.11053e-22

F1 sector of membrane-bound ATP synthase, alpha subunit

XFF4834R

XFF4834R_chr37230 lcl|rho-XFF4834R_chr37230

161

375

S=128 I=27 E=7.16002e-09

transcription termination factor

XFF4834R

XFF4834R_chr04010 lcl|XFF4834R_chr04110344_0451672_f2_XFF4834R-XFF4834R_chr04010

39

435

S=767 I=43 E=2.85079e-86

XFF4834R

XFF4834R_chr35450 lcl|atpD-XFF4834R_chr35450

122

438

S=258 I=27 E=1.3713e-24

F1 sector of membrane-bound ATP synthase, beta subunit

XFF4834R

XFF4834R_chr35470 lcl|atpA-XFF4834R_chr35470

122

438

S=242 I=26 E=1.11053e-22

F1 sector of membrane-bound ATP synthase, alpha subunit

XFF4834R

XFF4834R_chr37230 lcl|rho-XFF4834R_chr37230

161

375

S=128 I=27 E=7.16002e-09

transcription termination factor

X.species

YP_363726.1 lcl|fliI-XCV1995

1

458

S=1863 I=83 E=0

flagellar biosynthesis/type III secretory pathway ATPase FliI

X.species

NP_642277.1 lcl|fliI-XAC1951

1

458

S=1858 I=82 E=0

flagellar protein

X.species

NP_637288.1 lcl|fliI-XCC1923

1

458

S=1840 I=81 E=0

flagellar protein

X.species

lcl|fliI-XALc_1393

1

458

S=1713 I=75 E=0

probable flagellum-specific atp synthase protein

X.species

NP_636610.1 lcl|hrcN-XCC1236

39

435

S=769 I=43 E=5.98787e-86

type III secretion system ATPase

X.species

NP_640767.1 lcl|hrcN-XAC0412

39

435

S=768 I=43 E=8.05403e-86

type III secretion system ATPase

X.species

YP_362163.1 lcl|hrcN-XCV0432

39

435

S=766 I=43 E=1.53538e-85

type III secretion system ATPase

X.species

lcl|xsaS-XALc_1495

153

436

S=532 I=42 E=3.49422e-57

probable xanthomonas secretion apparatus protein

X.species

lcl|atpD-XALc_2906

122

438

S=271 I=27 E=1.30386e-25

probable atp synthase , beta subunit protein

X.species

NP_635946.1 lcl|atpD-XCC0554

122

438

S=262 I=27 E=1.81449e-24

F0F1 ATP synthase subunit beta

X.species

YP_365498.1 lcl|atpD-XCV3767

122

438

S=261 I=27 E=2.37758e-24

F0F1 ATP synthase subunit beta

X.species

NP_643956.1 lcl|atpD-XAC3649

122

438

S=258 I=27 E=5.211e-24

F0F1 ATP synthase subunit beta

X.species

lcl|atpA-XALc_2908

122

438

S=253 I=26 E=2.35498e-23

probable atp synthase, alpha subunit protein

X.species

NP_635944.1 lcl|atpA-XCC0552

122

438

S=243 I=26 E=3.83414e-22

F0F1 ATP synthase subunit alpha

X.species

YP_365500.1 lcl|atpA-XCV3769

122

438

S=242 I=26 E=4.44671e-22

F0F1 ATP synthase subunit alpha

X.species

NP_643958.1 lcl|atpA-XAC3651

122

438

S=242 I=26 E=4.44671e-22

F0F1 ATP synthase subunit alpha

X.species

lcl|Rho-XALc_2882

158

375

S=138 I=28 E=1.77635e-09

putative transcription termination factor rho protein

X.species

NP_644137.1 lcl|rho-XAC3831

161

375

S=127 I=27 E=3.89e-08

transcription termination factor Rho

X.species

NP_639123.1 lcl|rho-XCC3778

161

375

S=127 I=27 E=4.02806e-08

transcription termination factor Rho

X.species

YP_365687.1 lcl|rho-XCV3956

161

375

S=127 I=27 E=4.35687e-08

transcription termination factor Rho

pubmed

41

435

S=1146 I=58 E=5.23522e-130

FliI ; ATP-binding Nucleotide-binding

Pubmed 16385045

 

prodomImg

pubmed

38

439

S=1123 I=56 E=3.58944e-127

Polar flagellum-specific ATP synthase FliI ; ATP-binding Nucleotide-binding

Pubmed 10648530

 

prodomImg

pubmed

41

435

S=1043 I=54 E=1.43749e-117

Flagellar ATPase ; ATP-binding Flagellum Nucleotide-binding

Pubmed 11895941

 

prodomImg

pubmed

39

439

S=1032 I=53 E=3.74763e-116

Flagellum-specific ATP synthase EC=3.6.3.14 ; synthesis ATP-binding Bacterial biogenesis protein export Cytoplasm Hydrogen ion transport Hydro

Pubmed 1646201

 

prodomImg

pubmed

39

439

S=968 I=50 E=1.80541e-108

FliIL ; ATP-binding Nucleotide-binding

Pubmed 12514057,16428388

 

prodomImg

pubmed

122

437

S=960 I=61 E=2.00286e-107

Flagellum-specific ATP synthase EC=3.6.3.14 FliI ; ATP-binding Hydrolase Nucleotide-binding

Pubmed 16380199

 

prodomImg

pubmed

48

437

S=901 I=50 E=2.54176e-100

Flagella biosynthesis/type III secretory pathway ATPase ; ATP-binding Flagellum Nucleotide-binding

Pubmed 17933898

 

prodomImg

pubmed

41

439

S=893 I=45 E=2.51759e-99

Lateral flagellar FliI-like assembly ATPase protein ; ATP-binding Flagellum Nucleotide-binding

Pubmed 12867460

 

prodomImg

pubmed

39

435

S=868 I=45 E=2.69271e-96

Flagellum-specific ATP synthase EC=3.6.3.14 ; synthesis ATP-binding Bacterial biogenesis protein export Cytoplasm Hydrogen ion transport Hydrol

Pubmed 1828465

 

prodomImg

pubmed

41

439

S=860 I=45 E=2.22087e-95

Lateral flagellar export/assembly protein (LfiI-like) ; ATP-binding Flagellum Nucleotide-binding

Pubmed 15687208

 

prodomImg

sp

40

435

S=1072 I=55 E=3.42352e-121

Flagellum-specific ATP synthase EC=3.6.3.14 ; synthesis ATP-binding Bacterial biogenesis protein export Cytoplasm Hydrogen ion transport Hydrolase Nu

 

prodomImg

sp

39

439

S=1032 I=53 E=2.57924e-116

Flagellum-specific ATP synthase EC=3.6.3.14 ; synthesis ATP-binding Bacterial biogenesis protein export Cytoplasm Hydrogen ion transport Hydro

 

prodomImg

sp

39

439

S=1000 I=53 E=1.53687e-112

Flagellum-specific ATP synthase EC=3.6.3.14 ; synthesis ATP-binding Bacterial biogenesis protein export Cytoplasm Hydrogen ion transport Hydrol

 

prodomImg

sp

37

437

S=921 I=45 E=5.94385e-103

Flagellum-specific ATP synthase EC=3.6.3.14 ; synthesis ATP-binding Bacterial biogenesis protein export Cytoplasm Hydrogen ion transport Hydrolase Nu

 

prodomImg

sp

41

436

S=909 I=46 E=1.97808e-101

Flagellum-specific ATP synthase EC=3.6.3.14 ; synthesis ATP-binding Bacterial biogenesis protein export Cytoplasm Hydrogen ion transport Hydrolase Nu

 

prodomImg

PD889941

179

229

S=196 I=78 E=3.52197e-16

PDA1F756

274

308

S=162 I=89 E=4.21552e-12

PDA1D9M5

274

381

S=157 I=37 E=1.74603e-11

PDA1F728

309

347

S=148 I=77 E=1.88698e-10

PDA1U8S8

122

148

S=129 I=96 E=4.16499e-08

PD896765

1

40

S=114 I=63 E=2.55179e-06

PD650473

399

435

S=108 I=57 E=1.39705e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zUgv4e0F)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBa5gCJI/XFF4834R_chr20800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBa5gCJI/XFF4834R_chr20800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBa5gCJI/XFF4834R_chr20800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBa5gCJI/XFF4834R_chr20800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.