Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20670flhBXFF4834R_chr20670flagellar biosynthesis protein FlhB

flhB XFF4834R_chr20670
XFF4834R_chr20660
XFF4834R_chr20660
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4665
XFF4834R_chr_4665
ID flhB
AC XFF4834R_chr20670
LT XFF4834R_chr20670
OR XFF4834R_chr from 2391886 to 2393016 on strand -
DE flagellar biosynthesis protein FlhB
IP Type III secretion exporter; Flagellar biosynthetic protein FlhB
CL 1.6.12 Flagella GO:0009296
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)
Cellular Component: membrane (GO:0016020)

Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100424)
MW 41303.2 Da
SQ 376 aa
 
........10........20........30........40........50
| | | | |
MSESEDGGERTELPTEKRLREAREQGNIPQSRELSTAAVFGAGVFALMVL
ARGIGDGAAVWMKTALSPDPKMRENPMALFGHFGDLLLQLLWVMLPLIGI
CLAAGLAGPLMMSGLRFSGKAIMPDLTKLNPANGIKRMWGSNSLAELIKS
VLRLLFVGLAASFCISRGLHGLRSLVNQPLEQAIGNGLDFTKSLLFYTAG
ALVLLAAIDAPYQKWNWLRKLKMTREEIKREMKESEGSPEVKGRIRQMQM
QMSQRQMMEAVPKADVVLMNPTHYAVALKYEGGKMRAPIVVAKGVDEMAF
RIREAGEQHRVAIVTAPPLARALYREAQIGKEIPVRLYSVVAQVLSYVYQ
LRGWNGGPMPELPSLEVDEFGKGAGA
XFF4834R

XFF4834R_chr03950 lcl|XFF4834R_chr04070097_0447170_r2_XFF4834R-XFF4834R_chr03950

9

351

S=445 I=35 E=2.30715e-47

XFF4834R

XFF4834R_chr03950 lcl|XFF4834R_chr04070097_0447170_r2_XFF4834R-XFF4834R_chr03950

9

351

S=445 I=35 E=2.30715e-47

X.species

NP_642263.1 lcl|flhB-XAC1937

1

376

S=1798 I=93 E=0

flagellar biosynthesis protein FlhB

X.species

YP_363712.1 lcl|flhB-XCV1981

1

376

S=1782 I=92 E=0

flagellar biosynthesis protein FlhB

X.species

NP_637275.1 lcl|flhB-XCC1910

1

376

S=1718 I=87 E=0

flagellar biosynthesis protein FlhB

X.species

lcl|flhB-XALc_1383

1

370

S=1255 I=67 E=5.758e-145

probable flagellar biosynthesis pathway component flhb protein

X.species

YP_362157.1 lcl|hrcU-XCV0426

9

351

S=449 I=34 E=2.78309e-47

type III secretion system protein HrcU

X.species

NP_640761.1 lcl|hrcU-XAC0406

9

351

S=449 I=36 E=3.14441e-47

type III secretion system protein HrcU

X.species

NP_636604.1 lcl|hrcU-XCC1230

9

360

S=438 I=34 E=5.78404e-46

type III secretion system protein HrcU

X.species

lcl|xsaZ-XALc_1502

98

351

S=239 I=26 E=7.89614e-22

probable xanthomonas secretion apparatus protein

pubmed

1

376

S=1737 I=89 E=0

Flagellar biosynthetic protein FlhB ; Flagellum

Pubmed 11204784

 

prodomImg

pubmed

4

354

S=662 I=40 E=1.9818e-71

FlhB

Pubmed 16385045

 

prodomImg

pubmed

1

370

S=648 I=40 E=9.5119e-70

Flagellar biosynthetic protein flhB ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

Pubmed 8002587

 

prodomImg

pubmed

1

367

S=634 I=38 E=4.11185e-68

Polar flagellar assembly protein FlhB ; Flagellum

Pubmed 10648530

 

prodomImg

pubmed

1

374

S=558 I=38 E=6.82617e-59

FlhB ; Plasmid

Pubmed 17376080

 

prodomImg

pubmed

7

352

S=543 I=34 E=4.72518e-57

Flagellar biosynthetic protein flhB ; Bacterial flagellum biogenesis export Cell membrane transport Transmembrane

Pubmed 8299954

 

prodomImg

pubmed

1

366

S=521 I=35 E=2.26602e-54

Lateral flagellar export/assembly protein (FlhB-like) ; Flagellum

Pubmed 15687208

 

prodomImg

pubmed

1

357

S=520 I=33 E=3.02147e-54

FlhBL

Pubmed 12514057,16428388

 

prodomImg

pubmed

9

360

S=458 I=36 E=1.02702e-46

HrcU

Pubmed 16957248

 

prodomImg

pubmed

9

348

S=451 I=35 E=6.29753e-46

HrcU

Pubmed 11410350

 

prodomImg

sp

1

370

S=648 I=40 E=6.55019e-70

Flagellar biosynthetic protein flhB ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

 

prodomImg

sp

4

364

S=612 I=37 E=1.52088e-65

Flagellar biosynthetic protein flhB ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

 

prodomImg

sp

1

363

S=597 I=36 E=8.76636e-64

Flagellar biosynthetic protein flhB ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

 

prodomImg

sp

7

352

S=543 I=34 E=3.25391e-57

Flagellar biosynthetic protein flhB ; Bacterial flagellum biogenesis export Cell membrane transport Transmembrane

 

prodomImg

sp

112

363

S=474 I=36 E=7.08418e-49

Flagellar biosynthetic protein flhB ; Bacterial flagellum biogenesis export Cell membrane transport Transmembrane

 

prodomImg

PD775898

269

348

S=232 I=57 E=1.26915e-20

PD385815

52

85

S=184 I=97 E=8.30966e-15

PD002940

156

245

S=174 I=46 E=1.36474e-13

PD409775

104

163

S=137 I=42 E=4.15215e-09

PDA1R5D6

349

376

S=136 I=89 E=5.25423e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Vg8XM4OR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

68 hits
swiss-prot

Swiss-Prot ncbi-blastp

29 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBth7DQ8/XFF4834R_chr20670.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBth7DQ8/XFF4834R_chr20670.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBth7DQ8/XFF4834R_chr20670.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBth7DQ8/XFF4834R_chr20670.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.