Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20660flhAXFF4834R_chr20660flagellar biosynthesis protein FlhA

flhA XFF4834R_chr20660
XFF4834R_chr_2206
XFF4834R_chr_2206
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20670
XFF4834R_chr20670
ID flhA
AC XFF4834R_chr20660
LT XFF4834R_chr20660
OR XFF4834R_chr from 2389796 to 2391889 on strand -
DE flagellar biosynthesis protein FlhA
IP Type III secretion system FHIPEP; Flagellar biosynthesis protein FlhA
CL 1.6.12 Flagella GO:0009296
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)
Biological Process: protein transport (GO:0015031)
Cellular Component: integral to membrane (GO:0016021)
Cellular Component: membrane (GO:0016020)
Cellular Component: flagellum (GO:0019861)

Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: acur
CC STATUS: curated by poussier (20100424)
MW 74277.4 Da
SQ 697 aa
 
........10........20........30........40........50
| | | | |
MSARPAPMNARRVMELLRNGLGAPLALMAMLAMLMVPLAAPVLDALFTFN
IAISLMVLLAVVYVQRPLEFTIFPIVLLMTTMLRLALNVASSRVILINGQ
DGHAAAGKVIEAFGQFVIGGNYAVGIVVFAILTIINFVVITKGAGRVSEV
TARFILDAMPGKQMAIDADLNAGLLTREEAKARREEVRDEADFYGAMDGA
NKFIRGDAIAAILILFINLIGGMAVGMLQHGMSFMDAASTYTLLSIGDGL
VAQLPALLVSSSVALLVTRASRAQDMRGAMVSQVFGQHRALAVAAAILGL
VGLVPGMPNVAFLTLGLVLGVIARKLYKRSLAKPAAGDPAADPQAAAAAT
AAQASAELSWDELRPIDPLGLEVGYRLIPLVDKNQGGELMARIKGVRRKL
TQDIGFLVPPVHIRDNLELSANAYRLLVHGVPVATAEIYSDRELALDPGG
ALGQLDGIPGKDPAFGLDATWIQPHQRAYAESMGYTVVDPATVVATHLSH
LIREHAPELLGHEEVQQLLATLAKTAPKMVEDLTPKALPLSVVVRVLQNL
LIEKIPVRQLRKIVEALVEHAPHSQDPATLTAAVRTSLGRFIVQEIAGMS
AELPVFTLAPQLERVLQESTHGNGVALEPGLAERLHQSLADCVGKQEARN
EPAVVLVPGQVRAALARLVRHSVPSLSVLAYSEVPEDKRLKLVGTIS
XFF4834R

XFF4834R_chr03940 lcl|XFF4834R_chr04060166_0446103_r1_XFF4834R-XFF4834R_chr03940

44

249

S=388 I=45 E=3.44932e-40

XFF4834R

XFF4834R_chr03940 lcl|XFF4834R_chr04060166_0446103_r1_XFF4834R-XFF4834R_chr03940

509

696

S=205 I=30 E=6.39985e-18

XFF4834R

XFF4834R_chr03940 lcl|XFF4834R_chr04060166_0446103_r1_XFF4834R-XFF4834R_chr03940

44

249

S=388 I=45 E=3.44932e-40

XFF4834R

XFF4834R_chr03940 lcl|XFF4834R_chr04060166_0446103_r1_XFF4834R-XFF4834R_chr03940

509

696

S=205 I=30 E=6.39985e-18

X.species

YP_363711.1 lcl|flhA-XCV1980

1

697

S=2918 I=84 E=0

flagellar biosynthesis protein FlhA

X.species

NP_642262.1 lcl|flhA-XAC1936

1

697

S=2917 I=84 E=0

flagellar biosynthesis protein FlhA

X.species

NP_637274.1 lcl|flhA-XCC1909

1

697

S=2874 I=82 E=0

flagellar biosynthesis protein FlhA

X.species

lcl|flhA-XALc_1382

1

697

S=2554 I=74 E=0

probable flagellar biosynthesis pathway component , flha protein

X.species

lcl|xsaQ-XALc_1493

44

248

S=453 I=44 E=1.9187e-47

probable xanthomonas secretion apparatus protein

X.species

lcl|xsaQ-XALc_1493

469

696

S=202 I=25 E=4.55354e-17

probable xanthomonas secretion apparatus protein

X.species

YP_362156.1 lcl|hrcV-XCV0425

44

249

S=393 I=45 E=3.5425e-40

HrcV protein

X.species

YP_362156.1 lcl|hrcV-XCV0425

509

696

S=203 I=29 E=4.32146e-17

HrcV protein

X.species

NP_636603.1 lcl|hrcV-XCC1229

44

249

S=391 I=45 E=6.08237e-40

HrcV

X.species

NP_636603.1 lcl|hrcV-XCC1229

509

696

S=197 I=30 E=1.80558e-16

HrcV

X.species

NP_640760.1 lcl|hrcV-XAC0405

44

249

S=389 I=45 E=1.25416e-39

HrcV protein

X.species

NP_640760.1 lcl|hrcV-XAC0405

509

696

S=202 I=29 E=4.84011e-17

HrcV protein

pubmed

1

697

S=2907 I=83 E=0

Flagellar biosynthetic protein FlhA Flagellar protein ; Flagellum

Pubmed 11204784

 

prodomImg

pubmed

44

696

S=1676 I=50 E=0

Polar flagellar assembly protein FlhA ; Flagellum

Pubmed 10648530

 

prodomImg

pubmed

44

696

S=1638 I=49 E=0

Polar flagellar assembly protein ; Flagellum

Pubmed 16085838

 

prodomImg

pubmed

44

696

S=1595 I=50 E=0

FlhA Polar flagellar assembly protein ; Flagellum

Pubmed 16085838,16385045

 

prodomImg

pubmed

47

696

S=1448 I=47 E=1.88252e-166

FlhA ; Plasmid

Pubmed 17376080

 

prodomImg

pubmed

48

696

S=1342 I=44 E=1.67721e-153

Flagellar biosynthesis protein flhA ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

Pubmed 7783646

 

prodomImg

pubmed

44

696

S=1336 I=46 E=8.34265e-153

Flagellar biosynthesis protein flhA ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

Pubmed 8002587

 

prodomImg

pubmed

44

696

S=1319 I=45 E=9.91537e-151

Flagellar biosynthesis protein flhA ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

Pubmed 9387224

 

prodomImg

pubmed

44

697

S=1216 I=40 E=2.43082e-138

FlhA

Pubmed 17933898

 

prodomImg

pubmed

44

696

S=1187 I=40 E=8.73537e-135

FlhAL

Pubmed 12514057,16428388

 

prodomImg

sp

44

696

S=1373 I=46 E=1.84024e-157

Flagellar biosynthesis protein flhA ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

 

prodomImg

sp

48

696

S=1342 I=44 E=1.15542e-153

Flagellar biosynthesis protein flhA ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

 

prodomImg

sp

44

696

S=1336 I=46 E=5.74718e-153

Flagellar biosynthesis protein flhA ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

 

prodomImg

sp

44

696

S=1319 I=45 E=6.83062e-151

Flagellar biosynthesis protein flhA ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

 

prodomImg

sp

44

696

S=1197 I=39 E=3.35814e-136

Flagellar biosynthesis protein flhA ; Bacterial flagellum biogenesis export Cell membrane transport Transmembrane

 

prodomImg

PD001265

79

249

S=496 I=60 E=1.71404e-52

PD506710

363

474

S=385 I=61 E=5.17582e-39

PD586113

584

696

S=185 I=41 E=8.33885e-15

PDA1F7T3

477

525

S=170 I=67 E=6.40893e-13

PDA1F773

527

581

S=163 I=56 E=3.76224e-12

PD349320

44

78

S=119 I=60 E=9.69085e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 211bsb8B)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

173 hits
swiss-prot

Swiss-Prot ncbi-blastp

49 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEmMRq8/XFF4834R_chr20660.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEmMRq8/XFF4834R_chr20660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEmMRq8/XFF4834R_chr20660.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEmMRq8/XFF4834R_chr20660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.