Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20650flhFXFF4834R_chr20650flagellar gtp-binding protein flhf

flhF XFF4834R_chr20650
XFF4834R_chr20640
XFF4834R_chr20640
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2205
XFF4834R_chr_2205
ID flhF
AC XFF4834R_chr20650
LT XFF4834R_chr20650
OR XFF4834R_chr from 2387520 to 2389226 on strand -
DE flagellar gtp-binding protein flhf
IP Signal recognition particle, SRP54 subunit, GTPase; Signal-recognition particle (SRP)-type GTPase
CL 1.6.12 Flagella GO:0009296
EC
GO InterPro
Biological Process: SRP-dependent cotranslational protein targeting to membrane (GO:0006614)
Biological Process: flagellum organization (GO:0043064)
Cellular Component: plasma membrane (GO:0005886)
Molecular Function: GTP binding (GO:0005525)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: nucleotide binding (GO:0000166)

Curated
PM
AN
CC COG: [N] Cell motility;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100423)
MW 60594.3 Da
SQ 568 aa
 
........10........20........30........40........50
| | | | |
MKIKRFVAPDMRTAFRMVREEHGPDAVILSNRRTAEGIEIVAASNYDEEL
VQRALETARSDTPASAQHQQAPAQQAPAQQAPAPQAPAKPAAPVHALLKP
SADAEASQRQRVASAADDMIAAMALRQPVSVPRQAPVAAPVRTASIPSPA
AQALAHAVAVTAVPRQEHALSAVPEQLFADFLTTAPVQRPAVPATAVQAP
APVAAALVTAPAFAAAGQDDDAFADEADFDLDDALPQILPPAALPPIVVA
PPALAAVPVAATPAPQNDEELKQLRGELALMRQMIEREMNRLTDERLRGS
PVRAQALELMDDYGFDAGLTRDIALQIPADTELHRGRGLMLGLLSKRLPV
APVDPLERGGVIALVGPTGAGKTTTIAKLAQRFAAQHAPRDVALVTTDTQ
RVGGREQLHSYGRQLGIAVHEADSAESLLDLLERLRDYKLVLIDTAGMGQ
RDRALAAQLNWLRAAQQVTSLLVLPANAHFSDLDEVVRRFAHAKPQGVVL
TKLDETGRFGSALSVVVDHQMPITWVTDGQRVPDDLHRANAASLVLRLED
LRRAADKPCTPEHNHAVA
XFF4834R

XFF4834R_chr32460 lcl|ffh-XFF4834R_chr32460

361

551

S=151 I=30 E=1.71719e-11

Signal Recognition Particle (SRP) component with 4.5S RNA (ffs)

XFF4834R

XFF4834R_chr25750 lcl|XFF4834R_chr28310108_2986724_f3_XFF4834R-XFF4834R_chr25750

361

545

S=130 I=28 E=5.96434e-09

XFF4834R

XFF4834R_chr32460 lcl|ffh-XFF4834R_chr32460

361

551

S=151 I=30 E=1.71719e-11

Signal Recognition Particle (SRP) component with 4.5S RNA (ffs)

XFF4834R

XFF4834R_chr25750 lcl|XFF4834R_chr28310108_2986724_f3_XFF4834R-XFF4834R_chr25750

361

545

S=130 I=28 E=5.96434e-09

X.species

NP_642261.1 lcl|flhF-XAC1935

267

568

S=1376 I=89 E=2.10088e-159

flagellar biosynthesis regulator FlhF

X.species

NP_642261.1 lcl|flhF-XAC1935

1

182

S=562 I=69 E=9.21816e-61

flagellar biosynthesis regulator FlhF

X.species

YP_363710.1 lcl|flhF-XCV1979

267

568

S=1374 I=89 E=3.60716e-159

flagellar biosynthesis regulator FlhF

X.species

YP_363710.1 lcl|flhF-XCV1979

1

182

S=563 I=69 E=7.74309e-61

flagellar biosynthesis regulator FlhF

X.species

NP_637273.1 lcl|flhF-XCC1908

267

568

S=1351 I=88 E=2.6985e-156

flagellar biosynthesis regulator FlhF

X.species

NP_637273.1 lcl|flhF-XCC1908

1

182

S=339 I=52 E=1.02719e-33

flagellar biosynthesis regulator FlhF

X.species

lcl|flhF-XALc_1381

267

568

S=1208 I=78 E=4.60794e-139

probable flagellar gtp-binding protein flhf

X.species

lcl|flhF-XALc_1381

1

61

S=268 I=85 E=4.61119e-25

probable flagellar gtp-binding protein flhf

X.species

NP_641624.1 lcl|ffh-XAC1289

361

551

S=155 I=30 E=2.11604e-11

signal recognition particle protein

X.species

YP_363069.1 lcl|ffh-XCV1338

361

551

S=155 I=30 E=2.28877e-11

Signal recognition particle protein

X.species

NP_636568.1 lcl|ffh-XCC1194

361

551

S=153 I=31 E=3.89564e-11

signal recognition particle protein

X.species

lcl|ffh-XALc_0949

361

551

S=147 I=30 E=2.02408e-10

probable signal recognition particle (srp) component with 4.5s rna (ffs) protein

X.species

lcl|XALc_2076

353

545

S=133 I=27 E=1.00596e-08

hypothetical cell division protein

X.species

NP_642867.1 lcl|ftsY-XAC2552

361

545

S=130 I=28 E=2.46941e-08

cell division protein

X.species

YP_364481.1 lcl|ftsY-XCV2750

361

545

S=129 I=28 E=3.12484e-08

cell division protein FtsY

pubmed

267

568

S=1361 I=87 E=6.30552e-156

Flagellar biosynthetic protein FlhF ; Flagellum

Pubmed 11204784

 

prodomImg

pubmed

1

182

S=520 I=64 E=5.30717e-54

Flagellar biosynthetic protein FlhF ; Flagellum

Pubmed 11204784

 

prodomImg

pubmed

268

558

S=470 I=37 E=6.17794e-48

FlhF

Pubmed 16385045

 

prodomImg

pubmed

1

50

S=153 I=58 E=1.22336e-09

FlhF

Pubmed 16385045

 

prodomImg

pubmed

269

536

S=456 I=38 E=2.60168e-46

Flagellar biosynthesis protein FlhF ; Flagellum

Pubmed 10648530

 

prodomImg

pubmed

1

43

S=134 I=60 E=2.94623e-07

Flagellar biosynthesis protein FlhF ; Flagellum

Pubmed 10648530

 

prodomImg

pubmed

269

536

S=454 I=38 E=5.1807e-46

Putative GTP-binding protein

Pubmed 16428326

 

prodomImg

pubmed

1

43

S=136 I=63 E=1.68628e-07

Putative GTP-binding protein

Pubmed 16428326

 

prodomImg

pubmed

277

540

S=406 I=38 E=3.27577e-40

FlhF ; Plasmid

Pubmed 17376080

 

prodomImg

pubmed

271

537

S=392 I=35 E=1.47917e-38

FlhF

Pubmed 12423023

 

prodomImg

sp

274

559

S=377 I=33 E=7.42343e-37

Flagellar biosynthesis protein flhF ; Bacterial flagellum biogenesis export Cell membrane GTP-binding Nucleotide-binding transport

 

prodomImg

sp

1

46

S=139 I=54 E=4.9372e-08

Flagellar biosynthesis protein flhF ; Bacterial flagellum biogenesis export Cell membrane GTP-binding Nucleotide-binding transport

 

prodomImg

sp

267

559

S=357 I=31 E=2.05542e-34

Flagellar biosynthesis protein flhF ; Bacterial flagellum biogenesis export Cell membrane GTP-binding Nucleotide-binding transport

 

prodomImg

sp

1

46

S=153 I=61 E=1.0021e-09

Flagellar biosynthesis protein flhF ; Bacterial flagellum biogenesis export Cell membrane GTP-binding Nucleotide-binding transport

 

prodomImg

sp

356

545

S=307 I=33 E=1.92406e-28

Flagellar biosynthesis protein flhF ; Bacterial flagellum biogenesis export Cell membrane GTP-binding Nucleotide-binding transport

 

prodomImg

PD315415

94

182

S=264 I=66 E=1.99253e-24

PDA0B7Y9

364

548

S=157 I=27 E=1.59888e-11

PD113299

3

47

S=149 I=67 E=1.83669e-10

PDA1R7F6

438

462

S=132 I=100 E=1.80193e-08

PD787208

439

539

S=102 I=30 E=9.25791e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XrUQJBIa)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

38 hits
swiss-prot

Swiss-Prot ncbi-blastp

51 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ91V2l/XFF4834R_chr20650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ91V2l/XFF4834R_chr20650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ91V2l/XFF4834R_chr20650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ91V2l/XFF4834R_chr20650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.