Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20640fleNXFF4834R_chr20640Hypothetical flagellar biosynthesis switch protein

fleN XFF4834R_chr20640
XFF4834R_chr20630
XFF4834R_chr20630
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20650
XFF4834R_chr20650
ID fleN
AC XFF4834R_chr20640
LT XFF4834R_chr20640
OR XFF4834R_chr from 2386649 to 2387533 on strand -
DE Hypothetical flagellar biosynthesis switch protein
IP Cobyrinic acid a,c-diamide synthase
CL 5.1 Cell division GO:0000910
EC
GO InterPro
Biological Process: cobalamin biosynthetic process (GO:0009236)
c-diamide synthase activity (GO:0042242)

Curated
PM
AN
CC COG: [D] Cell cycle control, cell division, chromosome partitioning;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20130406)
MW 31644.2 Da
SQ 294 aa
 
........10........20........30........40........50
| | | | |
MQSREYAKLTNAFPLSATRPEPLGPVRTIAVTGGKGGVGKTNISANLAVA
LADMGKRTLLLDADLGLANLDVVLGLAPKYTLADLIAGRCTLDEVIIEGP
GGVLVVPAASGRRHMAELAPAQHIGLVNVFSELERDLDVMVIDTAAGITD
SVLTFCQAAQDTVVVVCDEPASITDAYALIKVLSRERGVDRLQIIANMVR
DPNEGRLLYDKLSRVCEKFLGDVSLNYLGHVPQDDWLRLSVQRQQPVIKA
YPASPSAQAIAEIARRTSRWQAPTVPRGNVEFFVERIIQRGVAA
X.species

YP_363709.1 lcl|fleN-XCV1978

1

294

S=1353 I=90 E=7.17062e-157

flagellar synthesis regulator FleN

X.species

NP_637272.1 lcl|fleN-XCC1907

1

294

S=1352 I=90 E=7.42511e-157

flagellar biosynthesis switch protein

X.species

NP_642260.1 lcl|fleN-XAC1934

1

294

S=1351 I=90 E=1.09925e-156

flagellar biosynthesis switch protein

X.species

lcl|fleN-XALc_1380

1

294

S=1202 I=78 E=1.37026e-138

probable flagellar synthesis regulator flen protein

pubmed

1

294

S=1351 I=90 E=4.095e-155

Flagellar biosynthesis switch protein Hypothetical flagellar biosynthesis switch protein ; Flagellum

Pubmed 11204784

 

prodomImg

pubmed

23

290

S=671 I=47 E=1.14713e-72

FleN

Pubmed 12423023

 

prodomImg

pubmed

23

290

S=668 I=47 E=2.14903e-72

Flagellar synthesis regulator FleN Flagellar number regulator ; Flagellum

Pubmed 10629180

 

prodomImg

pubmed

23

290

S=659 I=46 E=3.34959e-71

MotR

Pubmed 9721281,10689166

 

prodomImg

pubmed

78

289

S=632 I=55 E=5.12203e-68

Putative uncharacterized protein

Pubmed 9503621

 

prodomImg

pubmed

78

289

S=632 I=55 E=6.20505e-68

MinD homolog

Pubmed 10792727

 

prodomImg

pubmed

42

290

S=612 I=47 E=1.39369e-65

Flagellar biosynthesis protein FlhG ; Flagellum

Pubmed 10648530

 

prodomImg

pubmed

42

290

S=605 I=47 E=9.73993e-65

Putative ATP-binding protein

Pubmed 16428326

 

prodomImg

pubmed

26

294

S=604 I=43 E=1.21121e-64

FlhG

Pubmed 16385045

 

prodomImg

pubmed

118

290

S=300 I=36 E=1.03039e-27

Lfe160p2

Pubmed 12808145

 

prodomImg

sp

42

289

S=233 I=32 E=8.69617e-20

Uncharacterized ATP-binding protein MJ0547 ; Nucleotide-binding

 

prodomImg

sp

27

264

S=204 I=25 E=2.81461e-16

Uncharacterized protein ylxH ; ATP-binding Nucleotide-binding

 

prodomImg

sp

44

273

S=154 I=25 E=3.13666e-10

Septum site-determining protein minD ; ATP-binding Cell cycle division membrane Nucleotide-binding Septation

 

prodomImg

sp

44

273

S=138 I=26 E=2.58487e-08

Septum site-determining protein minD ; ATP-binding Cell cycle division membrane Nucleotide-binding Septation

 

prodomImg

sp

43

248

S=129 I=25 E=3.04803e-07

Putative septum site-determining protein minD ; ATP-binding Cell cycle division Chloroplast Nucleotide-binding Plastid Septation

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

27

292

-

Iprscan IPR002586 [PF01656]

29

239

Cobyrinic acid a,c-diamide synthase

Iprscan [seg]

31

41

-

Iprscan [seg]

59

77

-

PD092609

192

288

S=246 I=44 E=2.60518e-22

PDA2L690

92

188

S=141 I=34 E=1.28293e-09

PD249338

1

26

S=136 I=100 E=5.0871e-09

PD384185

81

189

S=113 I=29 E=3.28138e-06

PDA8E4V1

194

260

S=112 I=37 E=4.90045e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Wek6C1c6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUzbOeB/XFF4834R_chr20640.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUzbOeB/XFF4834R_chr20640.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUzbOeB/XFF4834R_chr20640.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUzbOeB/XFF4834R_chr20640.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.