Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20230rpfAXFF4834R_chr20230Probable aconitate hydratase

rpfA XFF4834R_chr20230
XFF4834R_chr20220
XFF4834R_chr20220
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20240
XFF4834R_chr20240
ID rpfA
AC XFF4834R_chr20230
LT XFF4834R_chr20230
OR XFF4834R_chr from 2320192 to 2322960 on strand -
DE Probable aconitate hydratase
IP
CL 1.3.4 Tricarboxylic acid cycle GO:0006099
EC
GO InterPro


Curated
PM
AN Homologue rpfA publie chez XCC
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101119)
MW 99192.8 Da
SQ 922 aa
 
........10........20........30........40........50
| | | | |
MSDSFSTRTSLEVHGKRYAYYSLPKLGERFDIGHLPYSMKILLENLLRHE
DGGVTVGKDHIEAVAKWDPTAEPDTEIAFMPARVVLQDFTGVPCVVDLAA
MRDAVVKLGGNADQINPQIPSELVIDHSVQVDVFGKPDALDLNGKIEFQR
NQERYGFLRWGQKAFENFKVVPPNTGIVHQVNLENLARVVMSADKEGTLV
AYPDTVFGTDSHTTMINGIGVLGWGVGGIEAEAAMLGQPSSMLIPQVVGF
KLTGKLPEGATATDLVLTVTQMLRKAGVVGKFVEFYGDGLQHLPLADRAT
IGNMAPEYGATCGIFPVDEESLTYLRLSGRSEEQIALVEAYAKAQGLWHD
ANTPPARYSATLELDMGQVKPSLAGPKRPQDRVLLEDMQSNYRESLKPFA
EARSKKLADLKQEDRLKNEGGGGTAVGAKASQAESASASGAGWQLRDGSV
VIAAITSCTNTSNPAVMLGAGLLARNAAARGLKAQPWVKTSLGPGSRVVT
DYLEKAGVLADLEKLGFYVVGYGCTTCIGNSGPLPEDVSAAIAKDDLVVT
SVLSGNRNFEGRVHPEVKMNYLASPPLVVAYAIAGTTDIDLTTEPLGTGS
DGQPVYLRDIWPSNKEIGDTIAATVGPEMFKQNYADVFKGDTRWNTIASP
DGALYEWDAASTYIKNPPYFDGMTMQVGNVDDVHGARIMGLLGDSITTDH
ISPAGNIKKDSPAGRFLQERGVQPADFNSYGSRRGNDDVMVRGTFANIRI
KNLMFGGEEGGNTLYYPANGGQPEKLAIYDAAMKYKADGVPLVVLAGKEY
GTGSSRDWAAKGTNLLGVRAVIAESFERIHRSNLVGMGVLPLQFLENENA
QTLGLDGSEVLDITGLQDGASRRATVDAKKPDGSVKQFQVKVLLLTPKEV
EYFRHGGLLQYVLRQLAARKAA
XFF4834R

XFF4834R_chr11330 acnA-XFF4834R_chr11330

444

922

S=1011 I=45 E=1.51948e-115

aconitate hydratase 1

XFF4834R

XFF4834R_chr11330 acnA-XFF4834R_chr11330

35

388

S=726 I=41 E=6.61672e-81

aconitate hydratase 1

XFF4834R

XFF4834R_chr11890 leuC-XFF4834R_chr11890

205

380

S=158 I=29 E=3.57505e-12

3-isopropylmalate isomerase subunit, dehydratase component

X.species

NP_642208.1 rpfA-XAC1882

1

922

S=4583 I=94 E=0

aconitate hydratase

X.species

YP_363655.1 acnA-XCV1924

1

922

S=4556 I=93 E=0

aconitate hydratase

X.species

NP_637225.1 rpfA-XCC1860

1

922

S=4429 I=91 E=0

aconitate hydratase

X.species

XALc_1349 acnA-XALc_1349

1

919

S=4112 I=83 E=0

probable aconitate hydratase 1 protein

X.species

XALc_0641 XALc_0641

444

910

S=1023 I=47 E=2.59856e-116

putative aconitate hydratase protein

X.species

XALc_0641 XALc_0641

35

383

S=723 I=43 E=5.38397e-80

putative aconitate hydratase protein

X.species

NP_636408.1 acnA-XCC1033

444

922

S=1018 I=45 E=9.52625e-116

aconitate hydratase

X.species

NP_636408.1 acnA-XCC1033

35

390

S=736 I=41 E=1.22394e-81

aconitate hydratase

X.species

NP_641475.1 acnA-XAC1139

444

910

S=1013 I=45 E=3.84382e-115

aconitate hydratase

X.species

NP_641475.1 acnA-XAC1139

35

383

S=733 I=41 E=2.9784e-81

aconitate hydratase

X.species

YP_362889.1 acnA-XCV1158

444

922

S=1011 I=45 E=5.79067e-115

aconitate hydratase

X.species

YP_362889.1 acnA-XCV1158

35

388

S=736 I=41 E=1.23466e-81

aconitate hydratase

X.species

NP_643765.1 leuC-XAC3458

205

380

S=164 I=30 E=2.98857e-12

isopropylmalate isomerase large subunit

X.species

YP_365317.1 leuC-XCV3586

205

380

S=155 I=29 E=3.74585e-11

isopropylmalate isomerase large subunit

X.species

NP_638677.1 leuC-XCC3331

205

380

S=151 I=28 E=1.06643e-10

isopropylmalate isomerase large subunit

X.species

XALc_0753 leuC-XALc_0753

205

379

S=110 I=21 E=9.23705e-06

probable 3-isopropylmalate dehydratase large subunit protein

X.species

XALc_0752 leuD-XALc_0752

793

888

S=110 I=33 E=9.48184e-06

probable 3-isopropylmalate dehydratase small subunit protein

pubmed

1

922

S=4390 I=90 E=0

Aconitase EC=4.2.1.3 ; Lyase

Pubmed 9663682

 

prodomImg

pubmed

121

918

S=3474 I=82 E=0

Aconitase

Pubmed 17574998

 

prodomImg

pubmed

2

916

S=2648 I=56 E=0

Aconitase EC=4.2.1.3 ; Lyase

Pubmed 11325949

 

prodomImg

pubmed

3

916

S=2647 I=56 E=0

Aconitate hydratase 1 EC=4.2.1.3 Putatice aconitate hydratase ; Lyase

Pubmed 16381882,17295914

 

prodomImg

pubmed

2

916

S=2609 I=55 E=0

Aconitase, AcnA

Pubmed 10559181

 

prodomImg

sp

3

916

S=2776 I=61 E=0

Aconitate hydratase 1 EC=4.2.1.3 ; 4Fe-4S Iron Iron-sulfur Lyase Metal-binding Tricarboxylic acid cycle

 

prodomImg

sp

3

916

S=2640 I=55 E=0

Aconitate hydratase EC=4.2.1.3 ; Iron Iron-sulfur Lyase Metal-binding Tricarboxylic acid cycle

 

prodomImg

sp

3

918

S=2640 I=55 E=0

Aconitate hydratase EC=4.2.1.3 ; Iron Iron-sulfur Lyase Metal-binding Tricarboxylic acid cycle

 

prodomImg

sp

3

915

S=2558 I=55 E=0

Aconitate hydratase EC=4.2.1.3 ; Iron Iron-sulfur Lyase Metal-binding Tricarboxylic acid cycle

 

prodomImg

sp

6

916

S=2543 I=56 E=0

Aconitate hydratase 1 EC=4.2.1.3 ; 4Fe-4S Iron Iron-sulfur Lyase Metal-binding Tricarboxylic acid cycle

 

prodomImg

PD000511

173

414

S=567 I=50 E=4.56536e-61

PD000511

445

617

S=457 I=53 E=9.55871e-48

PD664512

453

608

S=532 I=64 E=7.47919e-57

PD004178

680

763

S=330 I=71 E=2.83178e-32

PD537715

124

194

S=296 I=73 E=3.13362e-28

PD977780

607

672

S=242 I=58 E=1.20442e-21

PDA1R1M3

389

452

S=231 I=72 E=2.27421e-20

PD001077

793

848

S=219 I=70 E=7.70156e-19

PD926628

64

123

S=190 I=62 E=2.42834e-15

PD995518

335

423

S=180 I=48 E=3.88524e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5Upx7pzu)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

230 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRSpw0Y/XFF4834R_chr20230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRSpw0Y/XFF4834R_chr20230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRSpw0Y/XFF4834R_chr20230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRSpw0Y/XFF4834R_chr20230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.