Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20200rpfBXFF4834R_chr20200 secreted acyl-CoA synthetase (long-chain-fatty-acid--CoA ligase)

rpfB XFF4834R_chr20200
XFF4834R_chr20190
XFF4834R_chr20190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20210
XFF4834R_chr20210
ID rpfB
AC XFF4834R_chr20200
LT XFF4834R_chr20200
OR XFF4834R_chr from 2317573 to 2319255 on strand -
DE secreted acyl-CoA synthetase (long-chain-fatty-acid--CoA ligase)
IP AMP-dependent synthetase/ligase;
CL 1.1.2 Fatty acids (fatty acid oxidation) GO:0019395
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN pre-nomme fadA comme chez coli, malgre la regle de suivre coli j ai prefere mettre le nom rpfB comme chez les autres xantho car il y a 2 publi (oryzae et xcc) sur le cluster rpf
CC COG: [IQ] Lipid transport and metabolism;Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100824)
MW 61398.8 Da
SQ 560 aa
 
........10........20........30........40........50
| | | | |
MNQARPWLQSYPAGVAAEIDLEQFRTVAEVFATSVKRFADRPAYHSFGKT
ITYREADQLVEQFAAYLLGELQLKKGDRVALMMPNCLQYPIATFGVLRAG
LTVVNVNPLYTPRELKHQLIDSGASVLVVIDNFGTTVQQVIADTPVKQVI
TTGLGDMLGFPKAALLNFVVKYVKKLVPDYRINGAIRFREALALGRKHHV
PTLQIEPDDIAFLQYTGGTTGVAKGAMLTHRNLVANMQQAHQWLAGTGKL
EEGNEVVITALPLYHIFALTANGLVFMKIGGCNHLISNPRDMPGFVKELK
KTRFTAFTGVNTLFNGLLNTPGFDQVDFSSLKMTLGGGMAVQRSVAERWK
KVTGLTLVEAYGLTETSPAACINPMDLKDYNGSIGLPIPSTDACIKDDAG
AELPLGEIGELCIRGPQVMKGYWKKPEETAKVMDTEGWLHTGDIARMDAQ
GFVYIVDRKKDMILVSGFNVYPNEIEDVIAEMPGVLEVAAVGVPDDKSGE
IVKAVIVKKDPALTADAVKAHCRANLTGYKQPRVIEFRKELPKTNVGKIL
RRELRDAPKA
XFF4834R

XFF4834R_chr40480 lcl|acs-XFF4834R_chr40480

40

555

S=191 I=24 E=2.34237e-16

acetyl-CoA synthetase

XFF4834R

XFF4834R_chr38110 lcl|entF-XFF4834R_chr38110

207

425

S=156 I=29 E=4.18698e-12

enterobactin synthase multienzyme complex component, ATP-dependent

XFF4834R

XFF4834R_chr02080 lcl|XFF4834R_chr02170877_0246526_f2_XFF4834R-XFF4834R_chr02080

403

517

S=103 I=28 E=9.62119e-06

XFF4834R

XFF4834R_chr38100 lcl|XFF4834R_chr41190322_4401866_r2_XFF4834R-XFF4834R_chr38100

434

560

S=102 I=27 E=1.55413e-05

X.species

YP_363652.1 lcl|rpfB-XCV1921

1

559

S=2941 I=98 E=0

putative long-chain fatty acyl CoA ligase

X.species

NP_642206.1 lcl|rpfB-XAC1880

1

559

S=2860 I=96 E=0

putative long-chain fatty acyl CoA ligase

X.species

NP_637223.1 lcl|rpfB-XCC1858

1

560

S=2827 I=94 E=0

putative long-chain fatty acyl CoA ligase

X.species

lcl|rpfB-XALc_1348

1

557

S=2413 I=80 E=0

probable regulation of pathogenicity factor rpfb protein

X.species

YP_362647.1 lcl|XCV0916

202

556

S=496 I=33 E=8.37612e-53

acyl-CoA synthetase

X.species

NP_641233.1 lcl|XAC0881-XAC0881

202

556

S=495 I=33 E=1.10716e-52

acyl-CoA synthetase

X.species

NP_636198.1 lcl|XCC0807

202

557

S=476 I=32 E=2.59755e-50

acyl-CoA synthetase

X.species

lcl|XALc_0364

207

558

S=264 I=28 E=1.19044e-24

probable non-ribosomal peptide synthetase protein

X.species

NP_639207.1 lcl|entF-XCC3867

206

560

S=242 I=28 E=5.80934e-22

ATP-dependent serine activating enzyme

X.species

lcl|XALc_0772

27

554

S=241 I=26 E=7.16148e-22

probable non-ribosomal peptide synthetase protein

pubmed

1

560

S=2822 I=94 E=0

RpfB protein

Pubmed 9179849

 

prodomImg

pubmed

1

559

S=2810 I=94 E=0

RpfB

Pubmed 12036277

 

prodomImg

pubmed

1

560

S=2424 I=79 E=0

Long-chain fatty acyl CoA ligase

Pubmed 17574998

 

prodomImg

pubmed

7

560

S=1746 I=59 E=0

Long-chain-fatty-acid--CoA ligase EC=6.2.1.3 ; ATP-binding metabolism Lipid Membrane Nucleotide-binding

Pubmed 8107670,1460045

 

prodomImg

pubmed

7

557

S=1682 I=58 E=0

Putative long-chain fatty acid CoA ligase

Pubmed 16957232

 

prodomImg

pubmed

7

556

S=1680 I=56 E=0

Acyl-CoA synthetase

Pubmed 15305924

 

prodomImg

pubmed

7

556

S=1665 I=58 E=0

FadD1 Long-chain-fatty-acid-CoA ligase

Pubmed 10506180,11251808

 

prodomImg

pubmed

7

560

S=1509 I=52 E=6.07596e-174

Long-chain acyl-CoA synthetase

Pubmed 17351040

 

prodomImg

pubmed

3

556

S=1485 I=53 E=5.85303e-171

FadD2

Pubmed 11251808

 

prodomImg

pubmed

1

554

S=1015 I=41 E=4.52723e-114

Long-chain-fatty-acid--CoA ligase EC=6.2.1.3 ; ATP-binding metabolism Lipid Nucleotide-binding

Pubmed 8969504

 

prodomImg

Iprscan [G3DSA:3.40.50.980]

26

133

-

Iprscan [G3DSA:3.40.50.980]

206

384

-

Iprscan [G3DSA:2.30.38.10]

384

458

-

Iprscan [G3DSA:3.30.300.30]

460

556

-

Iprscan IPR000873 [PF00501]

52

490

AMP-dependent synthetase/ligase

Iprscan IPR020845 [PS00455]

213

224

AMP-binding, conserved site

PDA1G9B2

291

341

S=187 I=71 E=4.37586e-15

PDA1P170

30

63

S=186 I=100 E=5.25509e-15

PDA1P172

64

104

S=173 I=76 E=1.8752e-13

PD870036

138

191

S=171 I=61 E=3.60608e-13

PD664781

18

555

S=160 I=23 E=8.69179e-12

PDA1R2Y9

1

29

S=157 I=100 E=1.67146e-11

PD374777

250

290

S=152 I=76 E=6.62773e-11

PDA3X3V7

341

427

S=152 I=37 E=7.75393e-11

PDA1N1M8

485

528

S=148 I=59 E=2.30587e-10

PDA5C8N3

305

427

S=147 I=33 E=2.79343e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dYD3Xod4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX7Zuhi/XFF4834R_chr20200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX7Zuhi/XFF4834R_chr20200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX7Zuhi/XFF4834R_chr20200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX7Zuhi/XFF4834R_chr20200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.