Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20190rfpFXFF4834R_chr20190enoyl coA hydratase protein RpfF

rfpF XFF4834R_chr20190
XFF4834R_chr20180
XFF4834R_chr20180
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20200
XFF4834R_chr20200
ID rfpF
AC XFF4834R_chr20190
LT XFF4834R_chr20190
OR XFF4834R_chr from 2316528 to 2317397 on strand -
DE enoyl coA hydratase protein RpfF
IP Crotonase, core
CL 3.1.2.4.4 Quorum sensing GO:0009370 GO:0009369 GO:0009372
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN publi fonctionnelle Xcc et xoo. the rpfF gene is involved in production of a diffusible extracellular factor (DSF) that positively regulates (quorum sensing) synthesis of virulence-associated functions like extracellular polysaccharide (EPS) and extracellular enzymes.
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120313)
MW 31647.2 Da
SQ 289 aa
 
........10........20........30........40........50
| | | | |
MSAVQPFIRTNIGSTLRIVEEPQRDVYWIHMHADLAVNPGRACFSTRLVD
DITGYQSNLGQRLNNAGVLAPHVVLASDSDVFNLGGDLALFCQLIREGDR
ARLLDYAQRCVRGVHAFHVGLGARAHSIALVQGNALGGGFEAALSCHTIV
AEEGVMMGLPEVLFDLFPGMGAYSFMCQRVSAQLAQKIMLEGNLYSAEEL
LGMGLVDRVVPRGQGVAAVEQVIRESKRTPHAWAAMQQVREMTTAVPLEE
MMRITEIWVDTAMQLGEKSLRTMDRLVRAQSRRSGLDAG
XFF4834R

XFF4834R_chr31920 lcl|paaF-XFF4834R_chr31920

73

243

S=170 I=32 E=4.18597e-14

enoyl-CoA hydratase-isomerase

XFF4834R

XFF4834R_chr31830 lcl|fadJ-XFF4834R_chr31830

73

209

S=140 I=32 E=1.4152e-10

fused enoyl-CoA hydratase and epimerase and isomerase/3-hydroxyacyl-CoA dehydrogenase

XFF4834R

XFF4834R_chr29290 lcl|XFF4834R_chr31820199_3365981_f3_XFF4834R-XFF4834R_chr29290

128

210

S=125 I=36 E=1.04128e-08

XFF4834R

XFF4834R_chr08860 lcl|XFF4834R_chr09440000_1028827_r3_XFF4834R-XFF4834R_chr08860

64

211

S=106 I=27 E=2.20029e-06

XFF4834R

XFF4834R_chr32960 lcl|XFF4834R_chr35680747_3795517_f2_XFF4834R-XFF4834R_chr32960

73

210

S=93 I=29 E=7.25886e-05

X.species

YP_363651.1 lcl|rpfF-XCV1920

1

289

S=1513 I=98 E=2.87458e-176

enoyl-CoA hydratase

X.species

NP_637222.1 lcl|rpfF-XCC1857

1

289

S=1504 I=97 E=2.97411e-175

enoyl-CoA hydratase

X.species

NP_642205.1 lcl|rpfF-XAC1879

14

286

S=789 I=56 E=1.43819e-88

enoyl-CoA hydratase

X.species

lcl|rpfF-XALc_1347

14

284

S=736 I=50 E=3.54354e-82

probable enoyl-coa hydratase protein

X.species

YP_363096.1 lcl|XCV1365

73

243

S=168 I=32 E=2.7373e-13

enoyl-CoA hydratase

X.species

NP_641649.1 lcl|paaF-XAC1314

73

243

S=167 I=32 E=3.58678e-13

enoyl-CoA hydratase

X.species

NP_636636.1 lcl|paaF-XCC1262

73

243

S=165 I=31 E=6.10494e-13

enoyl-CoA hydratase

X.species

lcl|XALc_1063

128

258

S=158 I=33 E=3.49126e-12

hypothetical enoyl-coa hydratase/isomerase; protein

X.species

NP_636640.1 lcl|fadB-XCC1266

73

208

S=143 I=32 E=2.82736e-10

3-hydroxyacyl-CoA dehydrogenase

X.species

lcl|fadJ-XALc_2548

73

209

S=143 I=31 E=2.85212e-10

probable fatty acid oxidation complex, alpha subunit fadj protein

X.species

YP_363100.1 lcl|fadB-XCV1369

73

209

S=140 I=32 E=5.25077e-10

fatty oxidation complex alpha subunit

X.species

NP_641653.1 lcl|fadB-XAC1318

73

209

S=140 I=32 E=5.67939e-10

3-hydroxyacyl-CoA dehydrogenase

X.species

NP_636905.1 lcl|crt-XCC1534

128

210

S=133 I=39 E=4.56327e-09

3-hydroxybutyryl-CoA dehydratase

X.species

lcl|XALc_1985

128

210

S=130 I=37 E=9.82853e-09

putative 3-hydroxybutyryl-coa dehydratase protein

X.species

YP_363356.1 lcl|XCV1625

128

210

S=129 I=37 E=1.29914e-08

3-hydroxybutyryl-CoA dehydratase

X.species

NP_641916.1 lcl|crt-XAC1584

128

210

S=129 I=37 E=1.33357e-08

3-hydroxybutyryl-CoA dehydratase

X.species

lcl|XALc_3045

127

230

S=112 I=28 E=1.51736e-06

putative enoyl-coa hydratase protein

X.species

NP_636201.1 lcl|fadB-XCC0810

64

211

S=106 I=28 E=7.28886e-06

p-hydroxycinnamoyl CoA hydratase/lyase

X.species

YP_362649.1 lcl|paaF-XCV0918

64

211

S=106 I=27 E=7.54754e-06

p-hydroxycinnamoyl CoA hydratase/lyase

X.species

NP_641235.1 lcl|fadB-XAC0883

64

211

S=106 I=27 E=8.23513e-06

p-hydroxycinnamoyl CoA hydratase/lyase

pubmed

1

289

S=1504 I=97 E=1.22217e-173

RpfF protein

Pubmed 9179849

 

prodomImg

pubmed

1

289

S=1467 I=95 E=3.59095e-169

RpfF

Pubmed 12036277

 

prodomImg

pubmed

1

288

S=785 I=53 E=1.81992e-86

Enoyl CoA hydratase

Pubmed 17574998

 

prodomImg

pubmed

73

262

S=182 I=29 E=2.05633e-13

Putative enoyl-CoA hydratase

Pubmed 19854898

 

prodomImg

pubmed

128

258

S=168 I=33 E=9.12478e-12

DpgD protein

Pubmed 15113000,14702401

 

prodomImg

sp

73

255

S=168 I=29 E=6.60606e-12

Fatty acid oxidation complex subunit alpha EC=4.2.1.17 EC=5.3.3.8 EC=5.1.2.3 EC=1.1.1.35 ; metabolism Isomerase Lipid degradation Lyase Multifunctional enzyme NAD

 

prodomImg

sp

73

255

S=168 I=29 E=6.78113e-12

Fatty acid oxidation complex subunit alpha EC=4.2.1.17 EC=5.3.3.8 EC=5.1.2.3 EC=1.1.1.35 ; metabolism Isomerase Lipid degradation Lyase Multifunctional

 

prodomImg

sp

73

212

S=165 I=33 E=1.41049e-11

Fatty acid oxidation complex subunit alpha EC=4.2.1.17 EC=5.1.2.3 EC=1.1.1.35 ; Cytoplasm metabolism Isomerase Lipid degradation Lyase Multifunctional enzyme NAD

 

prodomImg

sp

69

230

S=165 I=30 E=1.44786e-11

Fatty acid oxidation complex subunit alpha EC=4.2.1.17 EC=5.1.2.3 EC=1.1.1.35 ; Cytoplasm metabolism Isomerase Lipid degradation Lyase Multifunctional enzyme NAD

 

prodomImg

sp

38

206

S=165 I=28 E=1.44786e-11

Probable enoyl-CoA hydratase EC=4.2.1.17 ; Fatty acid metabolism Lipid degradation Lyase

 

prodomImg

Iprscan [G3DSA:3.90.226.10]

18

231

-

Iprscan [PTHR11941]

73

283

-

Iprscan IPR001753 [PF00378]

73

211

Crotonase, core

PDA1M2X0

71

250

S=456 I=47 E=9.7858e-48

PD067592

1

63

S=294 I=83 E=3.98938e-28

PD687001

251

289

S=193 I=97 E=6.21516e-16

PDA3Q912

220

250

S=157 I=97 E=1.39363e-11

Iprscan [SSF52096]

73

285

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ihxlYW4a)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

80 hits
swiss-prot

Swiss-Prot ncbi-blastp

254 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCP72L4/XFF4834R_chr20190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCP72L4/XFF4834R_chr20190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCP72L4/XFF4834R_chr20190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCP72L4/XFF4834R_chr20190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.