Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20180rpfCXFF4834R_chr20180hybrid sensory histidine kinase/regulatory protein RpfC

rpfC XFF4834R_chr20180
XFF4834R_chr20170
XFF4834R_chr20170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20190
XFF4834R_chr20190
ID rpfC
AC XFF4834R_chr20180
LT XFF4834R_chr20180
OR XFF4834R_chr from 2314335 to 2316515 on strand +
DE hybrid sensory histidine kinase/regulatory protein RpfC
IP Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region; Signal transduction histidine kinase, phosphotransfer (Hpt) region; Signal transduction histidine kinase, hybrid-type, BC3207, predicted
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: signal transduction (GO:0007165)
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
Cellular Component: membrane (GO:0016020)
DNA-dependent (GO:0006355)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: two-component response regulator activity (GO:0000156)
Molecular Function: signal transducer activity (GO:0004871)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: protein histidine kinase activity (GO:0004673)

Curated
PM
AN involved in sensing and transducing the DSF signal
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110222)
MW 79321.5 Da
SQ 726 aa
 
........10........20........30........40........50
| | | | |
MKSPLPWLKRRLSGRADSEHAQNLIRIIITTLFISYLGWRYHHTHGDTLM
ATWLILVGELVVSLGLMVAILLRPQVSHTRRLIGMVLDYTCTGAIMAIQG
EPASPLYAVCMWVTIGNGLRYGSPYLRAATAMASLSFLSAILISPYWKAN
PYLSWGLLLGLIAVPLYFDSLLRAMTRAVREARHANQAKSRFLANMSHEF
RTPLNGLSGMTEVLATTRLDAEQKECLNTIQASARSLLSLVEEVLDISAI
EAGKIRIDRRDFSLREMIGSVNMILQPQAKTRGLDYGTEVATDVPDLLKG
DTGHLRQVLLNLLGNAVKFTEHGHVLLRVARVSGNGADTMRLRFDVEDSG
IGVPMDMRPRLFEAFEQADVGLSRRYEGTGLGTTIAKGLVEAMGGAIGFA
PNPSGGSVFWFELPLEIGVLDAATPARSPVGALLETPDELEASNVIAFSN
PFLRHRARVRSMRMLVADDHEANRMVLQRLLEKAGHKVTCVNGAEQVLDV
MADEDFDAVIVDLHMPGMSGLDMLKQLRVMQASGMRYTPVVVLSADVTPE
AIRACEQAGARAFLAKPVVAAKLLDTLAELAVSTRALATPAPVVQASTSF
EGVLDASVLDELAALGMGEEFERQFVRQCLDDAHNCVGAIERDGTRSDWE
QLRESAHALRGVASNLGLAQLAGSGGELMRMADWQLQAEWRQRLSALREQ
LQTGKDALAARVQGANDDERSPRSSE
XFF4834R

XFF4834R_chr35690 lcl|XFF4834R_chr38910286_4142022_f1_XFF4834R-XFF4834R_chr35690

106

585

S=562 I=32 E=2.95446e-61

XFF4834R

XFF4834R_chr16090 lcl|XFF4834R_chr17300019_1859594_f3_XFF4834R-XFF4834R_chr16090

182

580

S=545 I=37 E=3.76508e-59

XFF4834R

XFF4834R_chr21590 lcl|XFF4834R_chr23530104_2506487_r2_XFF4834R-XFF4834R_chr21590

172

586

S=522 I=35 E=2.58147e-56

XFF4834R

XFF4834R_chr04920 lcl|barA-XFF4834R_chr04920

171

426

S=512 I=44 E=4.09439e-55

hybrid sensory histidine kinase, in two-component regulatory system with UvrY

XFF4834R

XFF4834R_chr04920 lcl|barA-XFF4834R_chr04920

392

667

S=178 I=26 E=1.2517e-14

hybrid sensory histidine kinase, in two-component regulatory system with UvrY

XFF4834R

XFF4834R_chr24780 lcl|XFF4834R_chr27100302_2863396_f2_XFF4834R-XFF4834R_chr24780

162

602

S=496 I=33 E=3.37412e-53

XFF4834R

XFF4834R_chr24780 lcl|XFF4834R_chr27100302_2863396_f2_XFF4834R-XFF4834R_chr24780

458

718

S=146 I=29 E=8.06723e-11

XFF4834R

XFF4834R_chr16110 lcl|XFF4834R_chr17340755_1864378_f2_XFF4834R-XFF4834R_chr16110

182

579

S=461 I=34 E=5.92697e-49

XFF4834R

XFF4834R_chr16120 lcl|XFF4834R_chr17370806_1868315_f3_XFF4834R-XFF4834R_chr16120

182

586

S=437 I=34 E=5.18737e-46

XFF4834R

XFF4834R_chr32530 lcl|XFF4834R_chr35200757_3745873_f2_XFF4834R-XFF4834R_chr32530

175

414

S=411 I=41 E=7.1443e-43

X.species

YP_363650.1 lcl|rpfC-XCV1919

1

726

S=3699 I=97 E=0

sensory/regulatory protein RpfC

X.species

NP_637221.1 lcl|rpfC-XCC1856

1

726

S=3390 I=89 E=0

RpfC protein

X.species

lcl|rpfC-XALc_1346

4

713

S=2086 I=60 E=0

probable regulation of pathogenicity factor rpfc protein

X.species

NP_642204.1 lcl|rpfC-XAC1878

3

713

S=2048 I=59 E=0

RpfC protein

X.species

NP_643980.1 lcl|XAC3673-XAC3673

106

585

S=571 I=32 E=1.18394e-61

histidine kinase

X.species

YP_365524.1 lcl|XCV3793

106

585

S=568 I=32 E=2.23741e-61

two-component system sensor histidine kinase-response regulator hybrid protein

X.species

NP_643340.1 lcl|XAC3031-XAC3031

182

580

S=555 I=37 E=8.33961e-60

histidine kinase-response regulator hybrid protein

X.species

NP_638196.1 lcl|XCC2848

156

580

S=551 I=36 E=2.48004e-59

histidine kinase/response regulator hybrid protein

X.species

YP_364899.1 lcl|XCV3168

182

580

S=547 I=37 E=7.70379e-59

two-component system sensor histidine kinase-response regulator hybrid protein

X.species

NP_637714.1 lcl|XCC2360

162

602

S=536 I=34 E=1.95658e-57

two-component system sensor protein

pubmed

1

726

S=3384 I=88 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 11123673

 

prodomImg

pubmed

50

726

S=3237 I=91 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 8810082

 

prodomImg

pubmed

50

726

S=3116 I=88 E=0

Sensory/regulatory protein rpfC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transcription regulation

Pubmed 1645442

 

prodomImg

pubmed

33

711

S=2018 I=59 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17574998

 

prodomImg

pubmed

175

573

S=623 I=37 E=2.31826e-66

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 14660379

 

prodomImg

pubmed

189

602

S=589 I=39 E=3.02756e-62

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 12855730

 

prodomImg

pubmed

463

605

S=145 I=31 E=1.76067e-08

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 12855730

 

prodomImg

pubmed

156

603

S=563 I=32 E=4.09763e-59

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 12107144

 

prodomImg

pubmed

453

567

S=149 I=27 E=5.76773e-09

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 12107144

 

prodomImg

pubmed

175

603

S=561 I=33 E=6.22709e-59

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 16598018

 

prodomImg

Iprscan IPR003594 [G3DSA:3.30.565.10]

255

417

ATP-binding region, ATPase-like

Iprscan [G3DSA:3.40.50.2300]

455

580

-

Iprscan IPR003661 [PF00512]

188

253

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [PF02518]

300

416

ATP-binding region, ATPase-like

Iprscan IPR001789 [PF00072]

464

578

Signal transduction response regulator, receiver region

Iprscan IPR008207 [PF01627]

624

700

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR003661 [SM00388]

188

253

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [SM00387]

300

417

ATP-binding region, ATPase-like

Iprscan IPR001789 [SM00448]

462

577

Signal transduction response regulator, receiver region

Iprscan IPR008207 [SM00073]

614

712

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR005467 [PS50109]

195

417

Signal transduction histidine kinase, core

Iprscan IPR001789 [PS50110]

463

581

Signal transduction response regulator, receiver region

Iprscan IPR008207 [PS50894]

618

711

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan [seg]

133

144

-

Iprscan [tmhmm]

23

40

-

Iprscan [tmhmm]

50

72

-

Iprscan [tmhmm]

93

115

-

Iprscan [tmhmm]

125

147

-

Iprscan [tmhmm]

152

171

-

PD033584

55

181

S=315 I=54 E=1.79332e-30

PD252387

1

54

S=250 I=84 E=1.4577e-22

PD033813

674

726

S=211 I=81 E=6.68121e-18

PD033546

417

461

S=182 I=76 E=1.98189e-14

PDA1R0N6

207

247

S=169 I=83 E=9.18634e-13

PD643875

209

325

S=167 I=30 E=1.60501e-12

PDA453T2

209

309

S=134 I=33 E=1.6278e-08

PDA9M2U4

172

337

S=130 I=24 E=4.35989e-08

PDA5I8F2

463

581

S=128 I=29 E=6.86079e-08

PDA1B2Y2

185

293

S=127 I=30 E=1.07025e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ZFK75XUG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

56 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

19 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBm5n4fR/XFF4834R_chr20180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBm5n4fR/XFF4834R_chr20180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBm5n4fR/XFF4834R_chr20180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBm5n4fR/XFF4834R_chr20180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.