Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20170rpfHXFF4834R_chr20170putative membrane protein RpfH

rpfH XFF4834R_chr20170
XFF4834R_chr20160
XFF4834R_chr20160
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20180
XFF4834R_chr20180
ID rpfH
AC XFF4834R_chr20170
LT XFF4834R_chr20170
OR XFF4834R_chr from 2313698 to 2314327 on strand +
DE putative membrane protein RpfH
IP
CL 7.3 Inner membrane GO:0005886
EC
GO InterPro


Curated
PM
AN blast avec pvo rpfH , mutant xap rpfH, biblio sur xcc rpfH RpfH is different than RpfC because it has no histidine kinase (sensor), no regulatory and no transduction signal domains. It only has transmembrane domains
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110222)
MW 22724.8 Da
SQ 209 aa
 
........10........20........30........40........50
| | | | |
MRAALAQLRRRLARRPDSEHGQALVRIVMLWLILAYTLVCAPHWQLSDGH
LQRLLCLVAIGHGGALLLFAWIVAKPRPSHLRRTLGMLADYGLLSLAMTW
FAAPMACLYVVVMWVTIGNGLRFGRQALHTAVAMAMLSFGATLANSPYWQ
QRIQLGIALLAALVVIPLSLLRLMQDSADAAARIAAYAHGADAAGPHGPL
SSPSKRPQV
XFF4834R

XFF4834R_chr20180 lcl|XFF4834R_chr21680335_2316515_f3_XFF4834R-XFF4834R_chr20180

17

149

S=213 I=40 E=1.41025e-19

XFF4834R

XFF4834R_chr20180 lcl|XFF4834R_chr21680335_2316515_f3_XFF4834R-XFF4834R_chr20180

17

149

S=213 I=40 E=1.41025e-19

X.species

YP_363649.1 lcl|rpfH-XCV1918

16

209

S=731 I=77 E=8.8176e-82

putative membrane protein RpfH

X.species

NP_637220.1 lcl|rpfH-XCC1855

17

149

S=479 I=69 E=2.99185e-51

RpfH protein

X.species

lcl|rpfC-XALc_1346

16

149

S=311 I=47 E=8.16034e-31

probable regulation of pathogenicity factor rpfc protein

X.species

NP_642204.1 lcl|rpfC-XAC1878

16

149

S=242 I=49 E=1.62827e-22

RpfC protein

X.species

YP_363650.1 lcl|rpfC-XCV1919

17

149

S=211 I=40 E=9.78721e-19

sensory/regulatory protein RpfC

X.species

NP_637221.1 lcl|rpfC-XCC1856

17

149

S=209 I=40 E=1.54013e-18

RpfC protein

pubmed

17

149

S=480 I=69 E=9.6466e-50

Putative uncharacterized protein rpfH

Pubmed 11123673

 

prodomImg

pubmed

33

149

S=251 I=44 E=4.53057e-22

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17574998

 

prodomImg

pubmed

17

149

S=209 I=40 E=5.27833e-17

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 11123673

 

prodomImg

pubmed

65

149

S=177 I=46 E=4.49665e-13

Sensory/regulatory protein rpfC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transcription regulation

Pubmed 1645442

 

prodomImg

pubmed

65

149

S=175 I=46 E=7.32711e-13

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 8810082

 

prodomImg

sp

65

149

S=177 I=46 E=3.05792e-13

Sensory/regulatory protein rpfC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transcription regulation Transfe

 

prodomImg

sp

65

149

S=177 I=46 E=3.11171e-13

Sensory/regulatory protein rpfC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transcription regulation

 

prodomImg

PD033584

63

149

S=205 I=53 E=2.63658e-17

PD598831

16

61

S=194 I=76 E=5.20027e-16

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Mb8ZhiBg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUNa6Q2/XFF4834R_chr20170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUNa6Q2/XFF4834R_chr20170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUNa6Q2/XFF4834R_chr20170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUNa6Q2/XFF4834R_chr20170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.