Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20120XFF4834R_chr_2306995_2308209_r1_XFF4834R-XFF4834R_chr20120XFF4834R_chr20120putative membrane protein

XFF4834R_chr_2306995_2308209_r1_XFF4834R-XFF4834R_chr20120 XFF4834R_chr20120
XFF4834R_chr_2143
XFF4834R_chr_2143
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20130
XFF4834R_chr20130
ID XFF4834R_chr_2306995_2308209_r1_XFF4834R-XFF4834R_chr20120
AC XFF4834R_chr20120
LT XFF4834R_chr20120
OR XFF4834R_chr from 2306995 to 2308209 on strand -
DE putative membrane protein
IP Acyltransferase 3
CL 7.3 Inner membrane GO:0005886
EC
GO InterPro
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN publi sur xcc impliquant ce gene ds la regulation du cluster rpf pubmed 10784047 propose comme nom rpfL
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110222)
MW 46121.6 Da
SQ 404 aa
 
........10........20........30........40........50
| | | | |
MTERRHDIDALRVFAFALLILYHVGMAYVADWGFHLKSVHTAEWLQWPMI
VLNRWRMPLLFMISGIAIGLSQPQAAPWRFALRRCGRLLPPLLFGMFVVV
AVQAYCQGVSNGKVATGFGSFLLRYWQVRPWPAGSFDGWEHGITWNHLWY
LAYLLPYTVAVMALVSLARLVRLPALPPLPAATVVPALLVLPILWEAFCV
MWVMPRHPPTHALVGDWFVHAESFPLFLLGYLLARSERFWRLAVQLRWLT
LVAAVLAIATELGIRFLGMHVQPAQLPPALAALPWENLEHTARAAYTWLA
LLTLLGWAKQRLNRPFRWLPYCTEAVFPWYILHQSLIIVALYWLMPLQLN
AWLEPALVIAATVIGCLALHEYVIRRVRWLRPLFGLRGRTQAVNRQVGVT
AVAS
X.species

YP_363644.1 lcl|XCV1913

1

404

S=1513 I=75 E=3.76489e-176

hypothetical protein

X.species

NP_642199.1 lcl|XAC1873-XAC1873

1

396

S=1344 I=69 E=1.33388e-155

inner membrane protein

X.species

NP_637213.1 lcl|XCC1848

1

404

S=1137 I=61 E=1.22897e-130

inner membrane protein

X.species

NP_637215.1 lcl|XCC1850

3

111

S=189 I=44 E=1.08762e-15

inner membrane protein

X.species

NP_637214.1 lcl|XCC1849

319

391

S=160 I=53 E=3.31177e-12

membrane protein

pubmed

1

404

S=1126 I=60 E=1.15369e-127

Putative uncharacterized protein ; Membrane

Pubmed 10784047

 

prodomImg

pubmed

3

111

S=189 I=44 E=4.58171e-14

Putative uncharacterized protein ; Membrane

Pubmed 10784047

 

prodomImg

pubmed

319

391

S=158 I=53 E=2.39539e-10

Putative uncharacterized protein ; Membrane

Pubmed 10784047

 

prodomImg

Iprscan IPR002656 [PF01757]

5

369

Acyltransferase 3

Iprscan [seg]

82

93

-

Iprscan [seg]

159

194

-

Iprscan [seg]

249

262

-

Iprscan [seg]

272

284

-

Iprscan [seg]

291

308

-

Iprscan [SignalP-NN(euk)]

1

27

-

Iprscan [tmhmm]

13

35

-

Iprscan [tmhmm]

55

72

-

Iprscan [tmhmm]

85

107

-

Iprscan [tmhmm]

146

168

-

Iprscan [tmhmm]

175

197

-

Iprscan [tmhmm]

212

234

-

Iprscan [tmhmm]

246

268

-

Iprscan [tmhmm]

291

308

-

Iprscan [tmhmm]

325

347

-

Iprscan [tmhmm]

352

374

-

PD232265

110

149

S=207 I=95 E=1.18757e-17

PDA1I9M2

195

271

S=181 I=47 E=2.06971e-14

PD359146

313

389

S=122 I=49 E=2.53656e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6ibeMJ6K)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQPqWL/XFF4834R_chr20120.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQPqWL/XFF4834R_chr20120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQPqWL/XFF4834R_chr20120.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQPqWL/XFF4834R_chr20120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.