Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20110recJXFF4834R_chr20110Single-stranded-DNA-specific exonuclease

recJ XFF4834R_chr20110
XFF4834R_chr20100
XFF4834R_chr20100
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2143
XFF4834R_chr_2143
ID recJ
AC XFF4834R_chr20110
LT XFF4834R_chr20110
OR XFF4834R_chr from 2304993 to 2306669 on strand +
DE Single-stranded-DNA-specific exonuclease
IP Phosphoesterase, RecJ-like; Phosphoesterase, DHHA1
CL 2.1 DNA related GO:0006259
EC
GO InterPro
Biological Process: DNA repair (GO:0006281)
Biological Process: DNA recombination (GO:0006310)
Molecular Function: 5'-3' exonuclease activity (GO:0008409)
Molecular Function: hydrolase activity (GO:0016787)
Molecular Function: manganese ion binding (GO:0030145)
Molecular Function: nucleic acid binding (GO:0003676)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101104)
MW 59250.4 Da
SQ 558 aa
 
........10........20........30........40........50
| | | | |
MLPLLRRIYAARGVTDAQGAQPRLGQLLSPELLRNSGVAAELLADAIAQQ
RRILVVGDFDCDGATACAVGARGLRMLGALDVHHAVPNRMVHGYGLSPAL
VDELAALQPDVLVTVDHGIACHAGVAAAKARGWTVLVTDHHLPGEVLPPA
DAIVDPNLAEDTFPSKTLAGVGVIFYVLLALRKVLRARGAFAQRAEPDLS
VLLDLVAVGTVADLVPLDTNNRALVSAGLRRLREGKGCIGLRALIDASGR
DVARLSASDIGFALGPRLNAAGRLEDMALGIELLLSEDWGQAREIAGALE
EINAERRAVQQLMTDDAEHAVTKVVLDGDGALPIAACLFDAEWHPGVIGL
VASKLKDRLHRPVIALAPAEPGSSQLRGSARSIPGLHIRDVLAAVDARHP
GLIQKFGGHAMAAGLSIDHAALATFEQAFQAQVTAMVDASLLHAQLHSDG
ELAAHELDHLHAEALRVAGPWGQGFPEPLFDGQFEVLQHRVLKERHLKLT
LRCPGRAEPLNAIHFNGWRGSDPARLVRLAYRLVADDYRGGTAVQLIVEH
CEPATVTG
X.species

NP_642191.1 lcl|recJ-XAC1865

1

553

S=2639 I=94 E=0

single-stranded-DNA-specific exonuclease

X.species

YP_363643.1 lcl|XCV1912

1

558

S=2638 I=94 E=0

putative single-stranded-DNA-specific exonuclease

X.species

NP_637211.1 lcl|recJ-XCC1846

1

558

S=2456 I=87 E=0

putative single stranded DNA exonuclease

X.species

lcl|recJ-XALc_1342

2

552

S=1971 I=72 E=0

probable single-stranded-dna-specific exonuclease protein

pubmed

1

558

S=2442 I=86 E=0

Putative single stranded DNA exonuclease

Pubmed 10784047

 

prodomImg

pubmed

3

553

S=1237 I=47 E=5.39373e-141

Single-stranded-DNA-specific exonuclease recJ EC=3.1.-.- ; Hydrolase

Pubmed 1987126

 

prodomImg

pubmed

3

553

S=1234 I=47 E=1.23483e-140

Single-stranded-DNA-specific exonuclease recJ EC=3.1.-.- ; Hydrolase

Pubmed 2236050

 

prodomImg

pubmed

2

553

S=1226 I=49 E=1.22309e-139

Single-stranded-DNA-specific exonuclease recJ EC=3.1.-.- ; Hydrolase

Pubmed 8168497

 

prodomImg

pubmed

74

553

S=1076 I=48 E=2.16085e-121

Single-stranded DNA-specific exonuclease

Pubmed 12923078

 

prodomImg

pubmed

3

554

S=1051 I=46 E=2.3314e-118

RecJ

Pubmed 11085266

 

prodomImg

pubmed

3

554

S=1039 I=43 E=5.57063e-117

RecJ

Pubmed 18757541

 

prodomImg

pubmed

64

360

S=711 I=50 E=3.73563e-77

5'-3' exonuclease

Pubmed 18179430

 

prodomImg

pubmed

39

296

S=671 I=50 E=2.1107e-72

5'-3' exonuclease

Pubmed 18179430

 

prodomImg

pubmed

39

296

S=671 I=50 E=2.32316e-72

5'-3' exonuclease

Pubmed 18179430

 

prodomImg

sp

3

553

S=1237 I=47 E=3.71156e-141

Single-stranded-DNA-specific exonuclease recJ EC=3.1.-.- ; Hydrolase

 

prodomImg

sp

3

553

S=1234 I=47 E=8.49718e-141

Single-stranded-DNA-specific exonuclease recJ EC=3.1.-.- ; Hydrolase

 

prodomImg

sp

2

553

S=1226 I=49 E=8.41639e-140

Single-stranded-DNA-specific exonuclease recJ EC=3.1.-.- ; Hydrolase

 

prodomImg

sp

3

553

S=1142 I=43 E=1.37192e-129

Single-stranded-DNA-specific exonuclease recJ EC=3.1.-.- ; Hydrolase

 

prodomImg

sp

1

417

S=595 I=38 E=2.84563e-63

Putative single-strand DNA-specific exonuclease yrvE EC=3.1.-.- ; Coiled Hydrolase

 

prodomImg

Iprscan [coil]

295

316

-

Iprscan IPR001667 [PF01368]

46

211

Phosphoesterase, RecJ-like

Iprscan IPR003156 [PF02272]

360

431

Phosphoesterase, DHHA1

Iprscan IPR004610 [TIGR00644]

1

551

Bacterial RecJ exonuclease

Iprscan [seg]

177

188

-

Iprscan [seg]

451

465

-

PD566096

202

311

S=316 I=59 E=1.05607e-30

PD007759

110

194

S=201 I=49 E=8.54132e-17

PD009926

392

499

S=140 I=39 E=2.03066e-09

PD418247

3

63

S=116 I=41 E=1.62887e-06

PD824292

347

394

S=114 I=51 E=2.74838e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KrhgyFff)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt2ilBF/XFF4834R_chr20110.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt2ilBF/XFF4834R_chr20110.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt2ilBF/XFF4834R_chr20110.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt2ilBF/XFF4834R_chr20110.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.