Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr20100rpfEXFF4834R_chr20100RpfE regulatory protein

rpfE XFF4834R_chr20100
XFF4834R_chr20090
XFF4834R_chr20090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20110 3'-specific' />
XFF4834R_chr20110
ID rpfE
AC XFF4834R_chr20100
LT XFF4834R_chr20100
OR XFF4834R_chr from 2304013 to 2304933 on strand +
DE RpfE regulatory protein
IP Regulatory, RpfE; 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro


Curated
PM
AN 95% identitee avec RpfE regulatory protein de Xanthomonas oryzae pv. oryzae (strain PXO99A). mutant phaseoli fait se situe pres des memes genes lysU et recJ que chez les autres bacteries
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110708)
MW 33248.4 Da
SQ 306 aa
 
........10........20........30........40........50
| | | | |
MTTATLLLPEKRRLPGTLGDTAVARALARADGHTADAGEVAQLQRHFSLT
PAHWPVAALTRQLDAGDAAGATWVRADPAYVVPDMQGARLMGYGEALGPT
ADDLAVLLPILKPMFGDAGFLLDAPTPSRWYLRLSPDAKLPDFAAPDVAI
GDDLFEHLPAGDSGRRWRALLTEAQVLLHQHPWNEGRVASGKPAINSLWF
WGGGVLPHSVSSPHRQVRSRESMLCALALAAGADAQGEQRVDALVDLRHL
RSLQQFSDDAVAPLLAAMARGELDRLVLDFQDGESVSLTHAQRWRFWRKP
RVQLAQ
X.species

NP_642190.1 lcl|rpfE-XAC1864

1

306

S=1465 I=94 E=1.62105e-170

regulatory protein

X.species

YP_363642.1 lcl|rpfE-XCV1911

1

306

S=1453 I=94 E=5.53774e-169

putative regulatory protein RpfE

X.species

NP_637210.1 lcl|rpfE-XCC1845

1

306

S=1277 I=83 E=1.15174e-147

regulatory protein

X.species

lcl|rpfE-XALc_1341

1

304

S=835 I=55 E=4.33127e-94

putative regulatory protein rpfe

pubmed

1

306

S=1277 I=83 E=4.34841e-146

Regulatory protein

Pubmed 10784047

 

prodomImg

sp

151

211

S=124 I=38 E=1.44745e-06

Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase EC=5.4.2.1 ; Glycolysis Isomerase

 

prodomImg

sp

142

207

S=121 I=36 E=3.52231e-06

2,3-bisphosphoglycerate-independent phosphoglycerate mutase EC=5.4.2.1 ; Glycolysis Isomerase

 

prodomImg

sp

151

220

S=119 I=33 E=5.49464e-06

2,3-bisphosphoglycerate-independent phosphoglycerate mutase EC=5.4.2.1 ; Glycolysis Isomerase

 

prodomImg

sp

151

207

S=118 I=39 E=6.83285e-06

2,3-bisphosphoglycerate-independent phosphoglycerate mutase EC=5.4.2.1 ; Glycolysis Isomerase

 

prodomImg

sp

156

207

S=112 I=40 E=3.90754e-05

2,3-bisphosphoglycerate-independent phosphoglycerate mutase EC=5.4.2.1 ; Glycolysis Isomerase

 

prodomImg

PDA1K5R8

236

305

S=318 I=89 E=4.96731e-31

PD360239

43

154

S=283 I=61 E=8.57473e-27

PDA1R9M5

1

42

S=196 I=98 E=3.03685e-16

PD008732

161

207

S=124 I=50 E=1.623e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YjHBU5mh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtYDZkB/XFF4834R_chr20100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtYDZkB/XFF4834R_chr20100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtYDZkB/XFF4834R_chr20100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtYDZkB/XFF4834R_chr20100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.