Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr19620TXac4_likeXFF4834R_chr19620Xac4_like transposase ORFA

TXac4_like XFF4834R_chr19620
XFF4834R_chr19600
XFF4834R_chr19600
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19630
XFF4834R_chr19630
ID TXac4_like
AC XFF4834R_chr19620
LT XFF4834R_chr19620
OR XFF4834R_chr from 2254761 to 2255027 on strand -
DE Xac4_like transposase ORFA
IP Transposase IS3/IS911
CL 8.3.1 transposases GO:0004803
EC
GO InterPro
DNA-mediated (GO:0006313)
Molecular Function: transposase activity (GO:0004803)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN ISXac4 belongs to IS3 family. ISXac4 of Xac 306 contains 2 ORF (A and B), ORFAB encodes a putative transposase obtained by in silico fusion of the 2 peptides. Five remnants of an ISXac4-like are present in CFBP4834-R genome, probably corresponding to three copies of ISXac4-like. (1) The first copy corresponds to a small fragment of ISXac4-like, XFF4834R_chr00600 (containing a truncated ORFA); (2) the second copy contains in the middle of its sequence ISXax1 and xopT and consequently results into 2 fragments XFF4834R_chr23840 (containing ORFA annotated as XFF4834R_chr23850) and XFF4834R_chr23800 (with a truncated ORFB); (3) the third copy also contains an insertion of ISXax1 and results into 2 fragments XFF4834R_chr19610 (containing the ORFA annotated XFF4834R_chr19620) and XFF4834R_chr19580 (containing a truncated ORFB). Sequence divergence of ISXac4 and ISXac4-like would justify a specific name for ISXac4-like and a description in IS Finder. However there is no complete copy of ISXac4-like in CFBP4834-R genome and it is then not possible to submit in IS Finder
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120426)
MW 9944.5 Da
SQ 88 aa
 
........10........20........30........40........50
| | | | |
MRTSKFTETQIVATLKQADAGVPVKDICRQIGISTATHYQWKSKYGGLEA
SELRRIKELESENAKLKRMYTELALDNAAMKDLIAKKL
XFF4834R

XFF4834R_chr23850 lcl|XFF4834R_chr26040065_2752331_r2_XFF4834R-XFF4834R_chr23850

1

88

S=429 I=92 E=1.92105e-46

XFF4834R

XFF4834R_plc00450 lcl|XFF4834R_plc_0038060_0038326_r1_XFF4834R-XFF4834R_plc00450

1

87

S=261 I=53 E=5.37857e-26

XFF4834R

XFF4834R_pla00330 lcl|XFF4834R_pla00240942_0024208_r2_XFF4834R-XFF4834R_pla00330

1

87

S=261 I=53 E=5.37857e-26

XFF4834R

XFF4834R_chr15790 lcl|XFF4834R_chr17010041_1824307_r3_XFF4834R-XFF4834R_chr15790

1

87

S=258 I=51 E=1.12855e-25

XFF4834R

XFF4834R_chr15550 lcl|XFF4834R_chr16760670_1795936_f2_XFF4834R-XFF4834R_chr15550

1

87

S=258 I=51 E=1.12855e-25

XFF4834R

XFF4834R_chr05830 lcl|XFF4834R_chr_0658360_0658626_r1_XFF4834R-XFF4834R_chr05830

1

87

S=258 I=51 E=1.12855e-25

XFF4834R

XFF4834R_chr25050 lcl|XFF4834R_chr_2898230_2898496_r3_XFF4834R-XFF4834R_chr25050

1

87

S=257 I=51 E=1.71503e-25

XFF4834R

XFF4834R_chr15000 lcl|XFF4834R_chr16060824_1720090_r3_XFF4834R-XFF4834R_chr15000

1

87

S=257 I=51 E=1.71503e-25

XFF4834R

XFF4834R_plc_0033 lcl|XFF4834R_plc_0028367_0028633_r1_XFF4834R-XFF4834R_plc_0033

1

87

S=254 I=49 E=3.63004e-25

XFF4834R

XFF4834R_chr_3386 lcl|XFF4834R_chr34600896_3678162_f1_XFF4834R-XFF4834R_chr_3386

1

87

S=252 I=53 E=6.86003e-25

X.species

NP_642688.1 lcl|XAC2372-XAC2372

1

88

S=438 I=93 E=5.99561e-47

IS1479 transposase

X.species

NP_642916.1 lcl|XAC2603-XAC2603

1

88

S=432 I=92 E=2.66272e-46

ISxac4 transposase

X.species

NP_643810.1 lcl|XAC3503-XAC3503

5

88

S=396 I=87 E=6.80483e-42

ISxac4 transposase

X.species

lcl|XALc_2270

1

88

S=326 I=66 E=2.09972e-33

putative isxcc1 transposase orfa protein

X.species

NP_638483.1 lcl|XCC3136

1

88

S=326 I=66 E=2.31107e-33

ISxcc1 transposase

X.species

NP_638470.1 lcl|XCC3123

1

88

S=326 I=66 E=2.31107e-33

ISxcc1 transposase

X.species

YP_365093.1 lcl|XCV3362

1

88

S=322 I=65 E=6.08297e-33

ISxcc1 transposase

X.species

YP_363582.1 lcl|XCV1851

1

88

S=322 I=65 E=6.08297e-33

ISxcc1 transposase

X.species

YP_363578.1 lcl|XCV1847

1

88

S=322 I=65 E=6.08297e-33

ISxcc1 transposase

X.species

YP_363087.1 lcl|XCV1356

1

88

S=322 I=65 E=6.08297e-33

ISxcc1 transposase

pubmed

1

88

S=312 I=61 E=4.75687e-30

Transposase OrfA

Pubmed 9435062

 

prodomImg

pubmed

1

88

S=306 I=63 E=2.38685e-29

Transposase

Pubmed 17488332

 

prodomImg

pubmed

1

88

S=295 I=58 E=5.50765e-28

IS1400 transposase A

Pubmed 16902142

 

prodomImg

pubmed

1

88

S=285 I=55 E=7.08619e-27

Transposase 6

Pubmed 17049458

 

prodomImg

pubmed

1

88

S=272 I=53 E=3.22776e-25

Low calcium response locus protein S ; Plasmid

Pubmed 1577700

 

prodomImg

pubmed

1

88

S=272 I=53 E=3.22776e-25

Low calcium response locus protein S ; Plasmid

Pubmed 9746557,9748454

 

prodomImg

pubmed

1

87

S=271 I=54 E=3.87631e-25

Insertion element ISR1 uncharacterized 10 kDa protein A3 ; Transposable

Pubmed 2544911

 

prodomImg

pubmed

1

88

S=268 I=53 E=9.51543e-25

IS1400 transposase A

Pubmed 7607411,8955291

 

prodomImg

pubmed

1

87

S=252 I=52 E=7.91018e-23

Transposase ; Plasmid

Pubmed 16697042

 

prodomImg

pubmed

1

88

S=249 I=50 E=1.9082e-22

Putative transposase A

Pubmed 11150670

 

prodomImg

Iprscan [coil]

49

77

-

Iprscan IPR002514 [PF01527]

1

80

Transposase IS3/IS911

PD341800

1

39

S=148 I=72 E=1.83847e-10

PDA2H2T9

1

25

S=124 I=96 E=1.33984e-07

PDA3P0G0

1

25

S=120 I=92 E=4.3855e-07

PD895988

1

52

S=105 I=32 E=2.78224e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VNFo5jxb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

37 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

13 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_k9JVd/XFF4834R_chr19620.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_k9JVd/XFF4834R_chr19620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_k9JVd/XFF4834R_chr19620.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_k9JVd/XFF4834R_chr19620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.