Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr19180XFF4834R_chr19180putative glucose-6-phosphate isomerase

XFF4834R_chr19180
XFF4834R_chr19170
XFF4834R_chr19170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19190
XFF4834R_chr19190
ID
AC XFF4834R_chr19180
LT XFF4834R_chr19180
OR XFF4834R_chr from 2192583 to 2194097 on strand +
DE putative glucose-6-phosphate isomerase
IP Phosphoglucose isomerase (PGI)
CL 1.3.1 Glycolysis GO:0006096
EC
GO InterPro
Biological Process: glycolysis (GO:0006096)
Biological Process: gluconeogenesis (GO:0006094)
Molecular Function: glucose-6-phosphate isomerase activity (GO:0004347)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 54225.9 Da
SQ 504 aa
 
........10........20........30........40........50
| | | | |
MTHTNGFDALHAHAQRLRGAAIPALLAAEPERPTQYARQVGPLYFNFARQ
KYDRAALDALFAIARARDLSGAFQRLFRGEQVNVTEQRAALHTALRGDLT
DAAVASEAYATAADVRQRMGALIQQLEATEVTDIVSVGIGGSDLGPRLVA
DALRPVAGARLRVHFVSNVDGAAMQRTLATLDPARTAGILISKTFGTQET
LLNGSILHAWLGGSERLYAVSANPERAAKAFDIAPGRVLPMWDWVGGRYS
LWSAVGFPIALAIGFERFEQLLEGAAQFDAHVLNTPLEENVAVLHGLTAV
WNRNLLGSATHAVMTYDQRLALLPAYLQQLVMESLGKRVKLDGSAVDSDT
ASVWWGGAGTDVQHSFFQALHQGTSVVPADFIGTVHNDDPYAENHTALMA
NVLAQTEALANGQDSSDPHRSYPGGRPSTVILLDALTPQALGALISMYEH
SVYVQSVMWGINAFDQFGVELGKQLASQLLPALKGESADVADPVTRELLN
KLRG
X.species

YP_363550.1 lcl|pgi-XCV1819

1

504

S=2312 I=88 E=0

glucose-6-phosphate isomerase

X.species

NP_642115.1 lcl|pgi-XAC1788

1

504

S=2311 I=89 E=0

glucose-6-phosphate isomerase

X.species

NP_637137.1 lcl|pgi-XCC1771

1

504

S=2280 I=88 E=0

glucose-6-phosphate isomerase

X.species

lcl|pgi-XALc_1208

1

504

S=1974 I=76 E=0

putative glucose-6-phosphate isomerase (gpi) protein

pubmed

1

504

S=2311 I=89 E=0

Glucose-6-phosphate isomerase EC=5.3.1.9 ; Cytoplasm Gluconeogenesis Glycolysis

Pubmed 10584018

 

prodomImg

pubmed

76

504

S=959 I=46 E=2.56757e-107

Glucose-6-phosphate isomerase ; Plasmid

Pubmed 12673061

 

prodomImg

pubmed

72

503

S=918 I=42 E=2.36391e-102

Glucose-6-phosphate isomerase EC=5.3.1.9 ; Acetylation Angiogenesis Cytokine Cytoplasm Gluconeogenesis Glycolysis Phosphoprotein Secreted

Pubmed 3352744,7821788

 

prodomImg

pubmed

74

499

S=915 I=41 E=6.27652e-102

Glucose-6-phosphate isomerase EC=5.3.1.9 ; Cytoplasm Gluconeogenesis Glycolysis

Pubmed 18391199

 

prodomImg

pubmed

39

499

S=911 I=42 E=2.09053e-101

Glucose-6-phosphate isomerase EC=5.3.1.9 ; Cytoplasm Gluconeogenesis Glycolysis

Pubmed 1708765

 

prodomImg

sp

1

504

S=2312 I=88 E=0

Glucose-6-phosphate isomerase EC=5.3.1.9 ; Cytoplasm Gluconeogenesis Glycolysis

 

prodomImg

sp

1

504

S=2311 I=89 E=0

Glucose-6-phosphate isomerase EC=5.3.1.9 ; Cytoplasm Gluconeogenesis Glycolysis

 

prodomImg

sp

1

504

S=2311 I=89 E=0

Glucose-6-phosphate isomerase EC=5.3.1.9 ; Cytoplasm Gluconeogenesis Glycolysis

 

prodomImg

sp

1

504

S=2305 I=89 E=0

Glucose-6-phosphate isomerase EC=5.3.1.9 ; Cytoplasm Gluconeogenesis Glycolysis

 

prodomImg

sp

1

504

S=2304 I=88 E=0

Glucose-6-phosphate isomerase EC=5.3.1.9 ; Cytoplasm Gluconeogenesis Glycolysis

 

prodomImg

Iprscan IPR001672 [PR00662]

134

153

Phosphoglucose isomerase (PGI)

Iprscan IPR001672 [PR00662]

239

257

Phosphoglucose isomerase (PGI)

Iprscan IPR001672 [PR00662]

316

337

Phosphoglucose isomerase (PGI)

Iprscan IPR001672 [PR00662]

424

442

Phosphoglucose isomerase (PGI)

Iprscan IPR001672 [PR00662]

442

456

Phosphoglucose isomerase (PGI)

Iprscan IPR001672 [PR00662]

456

469

Phosphoglucose isomerase (PGI)

Iprscan [G3DSA:3.40.50.10490]

10

469

-

Iprscan IPR001672 [MF_00473]

40

483

Phosphoglucose isomerase (PGI)

Iprscan IPR001672 [PTHR11469]

28

503

Phosphoglucose isomerase (PGI)

Iprscan IPR001672 [PF00342]

47

486

Phosphoglucose isomerase (PGI)

Iprscan IPR018189 [PS00174]

456

473

Phosphoglucose isomerase, conserved site

Iprscan IPR018189 [PS00765]

243

256

Phosphoglucose isomerase, conserved site

Iprscan [seg]

16

33

-

Iprscan [seg]

53

69

-

Iprscan [seg]

102

113

-

PD001107

76

500

S=852 I=44 E=1.21364e-95

PD539676

356

473

S=135 I=31 E=8.99683e-09

PD344086

5

52

S=123 I=54 E=2.67325e-07

PDA6J1J5

453

503

S=120 I=50 E=5.41685e-07

Iprscan [SSF53697]

1

503

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JxdjfYxr)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

686 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBA8SV90/XFF4834R_chr19180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBA8SV90/XFF4834R_chr19180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBA8SV90/XFF4834R_chr19180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBA8SV90/XFF4834R_chr19180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.