Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr19030XFF4834R_chr20430502_2180906_r2_acur-XFF4834R_chr19030XFF4834R_chr19030DNA endonuclease

XFF4834R_chr20430502_2180906_r2_acur-XFF4834R_chr19030 XFF4834R_chr19030
XFF4834R_chr19020
XFF4834R_chr19020
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2041
XFF4834R_chr_2041
ID XFF4834R_chr20430502_2180906_r2_acur-XFF4834R_chr19030
AC XFF4834R_chr19030
LT XFF4834R_chr19030
OR XFF4834R_chr from 2180463 to 2180906 on strand -
DE DNA endonuclease
IP DNA mismatch endonuclease vsr
CL 2.1 DNA related GO:0006259
EC
GO InterPro
Biological Process: mismatch repair (GO:0006298)
Molecular Function: endonuclease activity (GO:0004519)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: acur
CC STATUS: curated by darrasse (20130515)
MW 16931.2 Da
SQ 147 aa
 
........10........20........30........40........50
| | | | |
MSVPSIAVSRRMAHTRGKDNPRERELRSALHRQGLRFRIHHAIPGTKRSI
DIAFTKWRLAVFCDGCFWHGCPIHATTPKTNREWWNNKIATNKARDLDTD
ARLKSSGWTALRIWEHVTLDDAVALIRSQLQQISACTPARAQRVNER
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one yl1NGLbU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

6 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMCGzcb/XFF4834R_chr19030.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMCGzcb/XFF4834R_chr19030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMCGzcb/XFF4834R_chr19030.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMCGzcb/XFF4834R_chr19030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.