Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr19020XFF4834R_chr_2179451_2180509_f2_XFF4834R-XFF4834R_chr19020XFF4834R_chr19020Cytosine-specific methyltransferase

XFF4834R_chr_2179451_2180509_f2_XFF4834R-XFF4834R_chr19020 XFF4834R_chr19020
XFF4834R_chr19010
XFF4834R_chr19010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19030
XFF4834R_chr19030
ID XFF4834R_chr_2179451_2180509_f2_XFF4834R-XFF4834R_chr19020
AC XFF4834R_chr19020
LT XFF4834R_chr19020
OR XFF4834R_chr from 2179451 to 2180509 on strand +
DE Cytosine-specific methyltransferase
IP DNA methylase, C-5 cytosine-specific; DNA methylase, C-5 cytosine-specific, active site
CL 2.1 DNA related GO:0006259
EC
GO InterPro
Biological Process: DNA methylation (GO:0006306)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN specifique de phaseoli, ne semble pas associe a une enzyme de restriction
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101103)
MW 38864.1 Da
SQ 352 aa
 
........10........20........30........40........50
| | | | |
MSRNQKNMPRIVGVDLFCGVGGLTHGLVRGGIQVAAGIDIDASCKFPFEA
NNSASFLECDVGKLKAEDITPFYEGVDFTLLAGCAPCQPFSTYSRSGRNS
EYESQWPLVSSFGRLVKSIKPDLVTMENVPQLADHPVFQQFLKSLSGYKK
WWQVVECSSIGIPQTRKRLVLLASRLGSDGLKLSQDQVRKVTVRDTIGLL
PPIKAGERDFQDELHAASSLSPLNLSRIRVSRPGGTWRDWPEELQASCHR
KETGATYPSVYGRMEWDQPAPTITTQCFGYGNGRFGHPEQDRAISLREAA
MLQTFPESYAFAPPGASIKFNKMGRLIGNAVPVRLGEVIARSLVGHVQVY
MH
pubmed

14

343

S=890 I=53 E=4.13432e-99

Modification methylase HgiDII EC=2.1.1.37 ; Methyltransferase Restriction system S-adenosyl-L-methionine

Pubmed 1937045,7607523

 

prodomImg

pubmed

1

340

S=416 I=34 E=1.16214e-41

DNA-cytosine methyltransferase ; Plasmid

Pubmed 17521723

 

prodomImg

pubmed

1

340

S=416 I=34 E=1.16214e-41

M.TspMI

Pubmed 17567609

 

prodomImg

pubmed

10

332

S=393 I=32 E=6.29672e-39

Cytosine-specific methyltransferase EC=2.1.1.37 ; Plasmid Restriction system

Pubmed 10518615

 

prodomImg

pubmed

14

344

S=325 I=30 E=1.2347e-30

Cytosine-specific methyltransferase EC=2.1.1.37 ; Restriction system

Pubmed 9321671

 

prodomImg

pubmed

14

343

S=303 I=29 E=5.19527e-28

MnlI m5C-methyltransferase

Pubmed 16024301

 

prodomImg

pubmed

14

344

S=301 I=31 E=8.53963e-28

Modification methylase Eco47II EC=2.1.1.37 ; Methyltransferase Restriction system S-adenosyl-L-methionine

Pubmed 7607524

 

prodomImg

pubmed

14

344

S=294 I=29 E=6.28853e-27

Modification methylase HphIA EC=2.1.1.37 ; Methyltransferase Restriction system S-adenosyl-L-methionine

Pubmed 8759008

 

prodomImg

pubmed

14

347

S=268 I=28 E=8.51116e-24

Cytosine-specific methyltransferase EC=2.1.1.37 ; Restriction system

Pubmed 11713319

 

prodomImg

pubmed

14

344

S=267 I=28 E=1.2822e-23

Cytosine-specific methyltransferase EC=2.1.1.37 ; Restriction system

Pubmed 12427957

 

prodomImg

sp

14

343

S=890 I=53 E=2.84594e-99

Modification methylase HgiDII EC=2.1.1.37 ; Methyltransferase Restriction system S-adenosyl-L-methionine

 

prodomImg

sp

14

344

S=301 I=31 E=5.87842e-28

Modification methylase Eco47II EC=2.1.1.37 ; Methyltransferase Restriction system S-adenosyl-L-methionine

 

prodomImg

sp

14

344

S=294 I=29 E=4.32883e-27

Modification methylase HphIA EC=2.1.1.37 ; Methyltransferase Restriction system S-adenosyl-L-methionine

 

prodomImg

sp

30

350

S=252 I=26 E=4.7447e-22

Modification methylase Sau96I EC=2.1.1.37 ; DNA-binding Methyltransferase Restriction system S-adenosyl-L-methionine Transcription regulation

 

prodomImg

sp

10

343

S=224 I=28 E=1.38312e-18

DNA (cytosine-5)-methyltransferase AthI EC=2.1.1.37 ; DNA-binding Nucleus Repeat S-adenosyl-L-methionine

 

prodomImg

Iprscan [G3DSA:3.40.50.150]

7

202

-

Iprscan IPR001525 [PF00145]

11

345

DNA methylase, C-5 cytosine-specific

Iprscan IPR001525 [TIGR00675]

13

343

DNA methylase, C-5 cytosine-specific

Iprscan IPR018117 [PS00095]

325

343

DNA methylase, C-5 cytosine-specific, active site

PD939274

195

286

S=178 I=45 E=3.93182e-14

PD000445

277

342

S=125 I=46 E=1.10411e-07

PD000554

287

344

S=112 I=43 E=4.07967e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ZtDcF3W6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

166 hits
swiss-prot

Swiss-Prot ncbi-blastp

58 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFqOYV8/XFF4834R_chr19020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFqOYV8/XFF4834R_chr19020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFqOYV8/XFF4834R_chr19020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFqOYV8/XFF4834R_chr19020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.