Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr18700ispAXFF4834R_chr18700probable geranyltranstransferase

ispA XFF4834R_chr18700
XFF4834R_chr18690
XFF4834R_chr18690
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18710
XFF4834R_chr18710
ID ispA
AC XFF4834R_chr18700
LT XFF4834R_chr18700
OR XFF4834R_chr from 2141338 to 2142213 on strand -
DE probable geranyltranstransferase
IP Polyprenyl synthetase; Terpenoid synthase
CL 1.5.3.19 Isoprenoid biosynthesis GO:0008299
EC
GO InterPro
Biological Process: isoprenoid biosynthetic process (GO:0008299)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100408)
MW 30500.3 Da
SQ 291 aa
 
........10........20........30........40........50
| | | | |
VSSALFDRWIARTERSLEAGLPSATHAPQRLHAAMRHAVLGGGKRMRPLL
VYASGALFGAAEDQLDTPAVAVELIHAYSLVHDDLPAMDDDALRRGQPTV
HIAFDEATAILAGDALQTRAFELLATAPASAELRVGWMQSLANAAGAAGM
CGGQALDIDATGQLQSLQHLQRMHALKTGALIRAAVRMGALTGGAAAADQ
QRLDEFADALGLAFQVRDDILDVESSSAQLGKTAGKDAAQSKSTYPALLG
MDGAKAKLAELAARMHDVLQPYGQPGETLATLGRFAVNRAH
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr17330 lcl|ispB-XFF4834R_chr17330

37

260

S=267 I=34 E=6.31643e-26

octaprenyl diphosphate synthase

XFF4834R

XFF4834R_chr17330 lcl|ispB-XFF4834R_chr17330

37

260

S=267 I=34 E=6.31643e-26

octaprenyl diphosphate synthase

X.species

NP_643071.1 lcl|ispA-XAC2762

1

291

S=1249 I=93 E=2.373e-144

farnesyl-diphosphate synthase

X.species

YP_364647.1 lcl|ispA-XCV2916

1

291

S=1238 I=92 E=5.1515e-143

geranyltranstransferase

X.species

NP_637948.1 lcl|ispA-XCC2600

1

291

S=1182 I=82 E=3.19833e-136

farnesyl-diphosphate synthase

X.species

lcl|IspA-XALc_2454

3

291

S=949 I=70 E=4.95968e-108

putative geranylgeranyl pyrophosphate synthase protein

X.species

YP_364781.1 lcl|ispB-XCV3050

37

251

S=269 I=35 E=1.42618e-25

octaprenyl-diphosphate synthase

X.species

NP_643215.1 lcl|ispB-XAC2906

37

251

S=268 I=35 E=1.80472e-25

octaprenyl-diphosphate synthase

X.species

lcl|XALc_1041

37

246

S=266 I=34 E=2.99244e-25

putative octaprenyl-diphosphate synthase protein

X.species

NP_638084.1 lcl|ispB-XCC2736

37

248

S=256 I=35 E=5.3624e-24

octaprenyl-diphosphate synthase

pubmed

6

289

S=659 I=50 E=2.58428e-71

Farnesyl diphosphate synthase (SelFPS) ; Isoprene biosynthesis Transferase

Pubmed 10412909

 

prodomImg

pubmed

6

255

S=508 I=43 E=6.24915e-53

Geranyl diphosphate synthase large subunit Geranyl pyrophosphate synthase large subunit Gpp synthase large subunit ; Isoprene biosynthesis Transferase

Pubmed 10557273

 

prodomImg

pubmed

6

272

S=506 I=44 E=9.25153e-53

Geranylgeranyl diphosphate synthase EC=2.5.1.29 ; Isoprene biosynthesis Transferase

Pubmed 17634749

 

prodomImg

pubmed

12

272

S=504 I=42 E=1.58846e-52

Geranylgeranyl pyrophosphate synthase 1 ; Isoprene biosynthesis Transferase

Pubmed 16786318

 

prodomImg

pubmed

5

283

S=501 I=41 E=4.52228e-52

Geranylgeranyl diphosphate synthase ; Isoprene biosynthesis Transferase

Pubmed 15352294

 

prodomImg

pubmed

6

261

S=500 I=43 E=4.72378e-52

Geranylgeranyl pyrophosphate synthetase, chloroplastic EC=2.5.1.1 EC=2.5.1.10 EC=2.5.1.29 ; Carotenoid biosynthesis Isoprene Multifunctional enzym

Pubmed 1303794,7888631

 

prodomImg

pubmed

35

261

S=500 I=53 E=4.97747e-52

Geranyltranstransferase EC=2.5.1.10 ; Cytoplasm Isoprene biosynthesis

Pubmed 2089044

 

prodomImg

pubmed

22

289

S=498 I=48 E=8.472e-52

Farnesyl diphosphate synthase Polyprenyl synthetase ; Isoprene biosynthesis Transferase

Pubmed 12189420

 

prodomImg

pubmed

12

273

S=498 I=42 E=1.02633e-51

Putative geranylgeranyl pyrophosphate synthase ; Isoprene biosynthesis Transferase

Pubmed 17186217

 

prodomImg

pubmed

6

274

S=497 I=41 E=1.25423e-51

Geranylgeranyl diphosphate synthase ; Isoprene biosynthesis Transferase

Pubmed 9826430

 

prodomImg

sp

12

261

S=531 I=49 E=7.16052e-56

Geranyltranstransferase EC=2.5.1.10 ; Cytoplasm Isoprene biosynthesis

 

prodomImg

sp

6

261

S=500 I=43 E=3.25618e-52

Geranylgeranyl pyrophosphate synthetase, chloroplastic EC=2.5.1.1 EC=2.5.1.10 EC=2.5.1.29 ; Carotenoid biosynthesis Isoprene Multifunctional enzym

 

prodomImg

sp

35

261

S=500 I=53 E=3.43105e-52

Geranyltranstransferase EC=2.5.1.10 ; Cytoplasm Isoprene biosynthesis

 

prodomImg

sp

28

255

S=496 I=46 E=1.00269e-51

Geranylgeranyl pyrophosphate synthetase, chloroplastic EC=2.5.1.1 EC=2.5.1.10 EC=2.5.1.29 ; Carotenoid biosynthesis Isoprene Multifunctional enzyme Plastid Transfe

 

prodomImg

sp

17

289

S=496 I=40 E=1.26883e-51

Geranyltranstransferase EC=2.5.1.10 ; Cytoplasm Isoprene biosynthesis

 

prodomImg

PD000572

6

248

S=406 I=43 E=1.0632e-41

PDA4B0N2

199

291

S=169 I=43 E=5.34963e-13

PDA28265

267

291

S=135 I=100 E=7.17157e-09

PDA2H3P5

255

291

S=134 I=70 E=8.46365e-09

PD410808

166

248

S=132 I=37 E=1.90416e-08

PD122970

40

241

S=125 I=28 E=1.15747e-07

PD153235

4

48

S=121 I=52 E=3.95737e-07

PDA348W4

216

255

S=118 I=53 E=7.94926e-07

PDA4H3X7

71

104

S=102 I=59 E=6.49399e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nMpv6Nre)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

127 hits
swiss-prot

Swiss-Prot ncbi-blastp

50 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrY_aEV/XFF4834R_chr18700.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrY_aEV/XFF4834R_chr18700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrY_aEV/XFF4834R_chr18700.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrY_aEV/XFF4834R_chr18700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.