Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr18580XFF4834R_chr19920044_2123721_r1_XFF4834R-XFF4834R_chr18580XFF4834R_chr18580putative TonB-like protein

XFF4834R_chr19920044_2123721_r1_XFF4834R-XFF4834R_chr18580 XFF4834R_chr18580
XFF4834R_chr18570
XFF4834R_chr18570
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18590
XFF4834R_chr18590
ID XFF4834R_chr19920044_2123721_r1_XFF4834R-XFF4834R_chr18580
AC XFF4834R_chr18580
LT XFF4834R_chr18580
OR XFF4834R_chr from 2123044 to 2123721 on strand -
DE putative TonB-like protein
IP Gram-negative bacterial tonB protein; TonB, C-terminal
CL 4.2.C.1 TonB Family of Auxiliary Proteins for Energization of OMR-mediated Transport
EC
GO InterPro
Biological Process: protein transport (GO:0015031)
Biological Process: iron ion transport (GO:0006826)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Cellular Component: membrane (GO:0016020)
Molecular Function: iron ion transmembrane transporter activity (GO:0005381)
Molecular Function: protein transporter activity (GO:0008565)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100508)
MW 23680 Da
SQ 225 aa
 
........10........20........30........40........50
| | | | |
MMVRTQSQVSSRPLGIDPSRVLAMSTAVALHLLAGGLLLIPLSHRAIPQQ
TAPKERWLMPVSIPTPPPPLAFPVEVTFTPKTHSPTKTLQAPVQTPVVTE
TSLVDSAPSAVAATVSDVVADSTPTTTTDPSGPIEAGQLQYLSSPAPSYP
AAALRAGQQGTVLLRVLVGTDGRPAEVSVQTSSGHRMLDLAARSQVLRNW
RFQPAMQNGQAVQAYGLVPVSFSLN
XFF4834R

XFF4834R_chr22140 lcl|XFF4834R_chr24110978_2562400_r3_XFF4834R-XFF4834R_chr22140

156

222

S=153 I=54 E=3.44903e-12

XFF4834R

XFF4834R_chr00080 lcl|XFF4834R_chr00080925_0011593_f2_XFF4834R-XFF4834R_chr00080

155

225

S=131 I=45 E=1.27335e-09

XFF4834R

XFF4834R_chr28570 lcl|XFF4834R_chr31110171_3289749_f1_XFF4834R-XFF4834R_chr28570

156

223

S=101 I=40 E=6.48538e-06

XFF4834R

XFF4834R_chr28560 lcl|XFF4834R_chr31080263_3288925_f2_XFF4834R-XFF4834R_chr28560

174

223

S=95 I=42 E=3.0883e-05

XFF4834R

XFF4834R_chr12880 lcl|XFF4834R_chr_1467687_1468991_f3_XFF4834R-XFF4834R_chr12880

156

225

S=92 I=33 E=7.38534e-05

XFF4834R

XFF4834R_chr22140 lcl|XFF4834R_chr24110978_2562400_r3_XFF4834R-XFF4834R_chr22140

156

222

S=153 I=54 E=3.44903e-12

XFF4834R

XFF4834R_chr00080 lcl|XFF4834R_chr00080925_0011593_f2_XFF4834R-XFF4834R_chr00080

155

225

S=131 I=45 E=1.27335e-09

XFF4834R

XFF4834R_chr28570 lcl|XFF4834R_chr31110171_3289749_f1_XFF4834R-XFF4834R_chr28570

156

223

S=101 I=40 E=6.48538e-06

XFF4834R

XFF4834R_chr28560 lcl|XFF4834R_chr31080263_3288925_f2_XFF4834R-XFF4834R_chr28560

174

223

S=95 I=42 E=3.0883e-05

XFF4834R

XFF4834R_chr12880 lcl|XFF4834R_chr_1467687_1468991_f3_XFF4834R-XFF4834R_chr12880

156

225

S=92 I=33 E=7.38534e-05

X.species

NP_643083.1 lcl|XAC2774-XAC2774

1

225

S=735 I=73 E=3.09306e-82

TonB-like protein

X.species

YP_364661.1 lcl|tonB4-XCV2930

2

225

S=662 I=70 E=2.38405e-73

TonB-like protein

X.species

NP_637960.1 lcl|tonB-XCC2612

1

225

S=543 I=59 E=5.83492e-59

TonB like protein

X.species

YP_364158.1 lcl|XCV2427

156

222

S=162 I=57 E=8.45897e-13

putative secreted protein

X.species

NP_642432.1 lcl|XAC2115-XAC2115

156

222

S=153 I=54 E=1.10748e-11

hypothetical protein

X.species

lcl|tonB3-XALc_1701

155

222

S=140 I=47 E=4.09213e-10

putative tonb_protein

X.species

lcl|XALc_0008

155

225

S=139 I=46 E=4.91435e-10

putative energy transducer tonb protein

X.species

NP_635403.1 lcl|tonB-XCC0008

155

225

S=134 I=45 E=2.18252e-09

TonB protein

X.species

YP_361739.1 lcl|tonB1-XCV0008

155

225

S=131 I=45 E=4.70079e-09

energy transducer TonB protein

X.species

NP_640364.1 lcl|tonB-XAC0008

155

225

S=131 I=45 E=4.70079e-09

TonB protein

X.species

NP_637446.1 lcl|XCC2081

157

223

S=130 I=46 E=7.26936e-09

hypothetical protein

X.species

lcl|tonB-XALc_1614

170

223

S=113 I=48 E=8.41669e-07

putative tonb protein

X.species

YP_363423.1 lcl|tonB2-XCV1692

155

223

S=112 I=41 E=1.00201e-06

TonB-like protein

X.species

NP_641983.1 lcl|XAC1651-XAC1651

155

223

S=104 I=39 E=1.00994e-05

TonB-like protein

X.species

NP_641984.1 lcl|XAC1652-XAC1652

172

223

S=101 I=42 E=2.21351e-05

hypothetical protein

X.species

YP_363424.1 lcl|tonB3-XCV1693

172

223

S=101 I=42 E=2.35281e-05

TonB-like protein

X.species

YP_365210.1 lcl|blaR1-XCV3479

156

225

S=97 I=34 E=5.98057e-05

putative BlaR1 antirepressor (fragment)

X.species

NP_643669.1 lcl|XAC3362-XAC3362

156

225

S=96 I=34 E=8.62533e-05

TonB-like protein

pubmed

155

225

S=146 I=48 E=2.83309e-09

Protein tonB2 ; Cell inner membrane transport Transmembrane

Pubmed 10689178

 

prodomImg

pubmed

155

225

S=137 I=38 E=3.45929e-08

Uvs044

Pubmed 14532085

 

prodomImg

pubmed

155

225

S=134 I=45 E=7.78273e-08

TonB

Pubmed 12646254

 

prodomImg

pubmed

155

225

S=134 I=45 E=7.78273e-08

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

158

224

S=118 I=43 E=6.93717e-06

TonB

Pubmed 11292789

 

prodomImg

pubmed

155

225

S=110 I=33 E=5.77169e-05

TonB2 protein

Pubmed 15689115

 

prodomImg

sp

155

225

S=146 I=48 E=1.95865e-09

Protein tonB2 ; Cell inner membrane transport Transmembrane

 

prodomImg

sp

155

225

S=134 I=45 E=5.38057e-08

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

 

prodomImg

sp

155

225

S=134 I=45 E=5.38057e-08

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

 

prodomImg

PD601648

2

103

S=255 I=65 E=1.97152e-23

PD918058

177

225

S=113 I=54 E=3.08546e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one iCr2JPR2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt7ZUBi/XFF4834R_chr18580.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt7ZUBi/XFF4834R_chr18580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt7ZUBi/XFF4834R_chr18580.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt7ZUBi/XFF4834R_chr18580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.