Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr18460xopF2XFF4834R_chr18460Xanthomonas outer protein F2, Type III effector XopF2

xopF2 XFF4834R_chr18460
XFF4834R_chr18440
XFF4834R_chr18440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18470
XFF4834R_chr18470
ID xopF2
AC XFF4834R_chr18460
LT XFF4834R_chr18460
OR XFF4834R_chr from 2110204 to 2111493 on strand +
DE Xanthomonas outer protein F2, Type III effector XopF2
IP
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20130311)
MW 45318.2 Da
SQ 429 aa
 
........10........20........30........40........50
| | | | |
MGSHTCDTLLIPSMDRRARVANLPRFQAIDPKILVPDPPPVLLEVTPEGG
KRFVLPGENGTPIRAELTAQAYDRRAGIAQRQSVLDDTALDTMLLRPTIS
GGFNAARRTSGNPATRTAVAEVGLAGLAVGGAGSLQKALLDTGKAMGRTG
QMTVPDLLGGHQRLNLFALALPDKTRPPAKWSDAVHFPSYLLQTGQEAVA
LARQAFSTANAATTALRDVLGRHMVGNVLANMASLGATRLIASPLRGGYG
GGSLPGEADNSPAWVLQQGAQMFFNDVVWNALKAKNGTNTTQATRLDQER
AIAAAEQDRTISRALQKLAEPLDAALGLHWPQAQSEVARAMEEGTGVPVP
LSPDVGRLRNALQQLRGQVAAQAVSIATIDDALGRLADLSIAVEGEGRAV
IAELSAQLNALGAALRQKEELQQWQRGRP
XFF4834R

XFF4834R_chr03830 lcl|XFF4834R_chr03970052_0438061_f2_XFF4834R-XFF4834R_chr03830

3

428

S=966 I=52 E=2.36022e-110

X.species

YP_364673.1 lcl|xopF2-XCV2942

1

429

S=1692 I=82 E=0

outer protein F2

X.species

YP_362145.1 lcl|xopF1-XCV0414

3

428

S=1005 I=53 E=1.44004e-114

outer protein F1

X.species

NP_636592.1 lcl|XCC1218

150

429

S=723 I=57 E=2.261e-80

hypothetical protein

X.species

NP_643094.1 lcl|XAC2785-XAC2785

277

429

S=512 I=70 E=7.90795e-55

hypothetical protein

pubmed

3

428

S=935 I=51 E=1.7114e-104

Hpa4

Pubmed 15986924

 

prodomImg

pubmed

3

428

S=928 I=51 E=1.19603e-103

Hpa4

Pubmed 16957248

 

prodomImg

Iprscan [coil]

401

422

-

Iprscan [seg]

31

47

-

Iprscan [seg]

118

135

-

Iprscan [seg]

243

256

-

PD669199

150

313

S=531 I=65 E=8.62461e-57

PDA0D438

1

149

S=477 I=64 E=2.85826e-50

PD606155

285

429

S=410 I=62 E=3.98909e-42

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one kOARPDko)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZwOpeC/XFF4834R_chr18460.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZwOpeC/XFF4834R_chr18460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZwOpeC/XFF4834R_chr18460.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZwOpeC/XFF4834R_chr18460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.