Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr18440XFF4834R_chr19780048_2109494_f3_XFF4834R-XFF4834R_chr18440XFF4834R_chr18440Conserved hypothetical protein

XFF4834R_chr19780048_2109494_f3_XFF4834R-XFF4834R_chr18440 XFF4834R_chr18440
XFF4834R_chr18440
XFF4834R_chr18440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18460
XFF4834R_chr18460
ID XFF4834R_chr19780048_2109494_f3_XFF4834R-XFF4834R_chr18440
AC XFF4834R_chr18440
LT XFF4834R_chr18440
OR XFF4834R_chr from 2109048 to 2109494 on strand +
DE Conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN Identite de 53% sur 94% de longueur avec hpa3 de Xoo MAIS identite de 78% sur toute longueur d'1 hypothetical protein chez Xcv ; paralogue de chr0421 annote comme hpa3.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by bonneau (20101015)
MW 15770.1 Da
SQ 148 aa
 
........10........20........30........40........50
| | | | |
MTSNQINIDSMVASFFSGLGIRLGLTDALVQRLREGETVLGPAGMLCRVH
AQPQDDGVSGFPEVILPLAARELGGDEVVTLLALQEQLLTEYGWRLTMSN
LGLLCICPLLLAQTPEDVAATLERGQLVARIVLDALVTQSGSAREAVV
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr03820 lcl|XFF4834R_chr03960609_0436055_f3_XFF4834R-XFF4834R_chr03820

1

139

S=357 I=54 E=2.80617e-37

X.species

YP_364674.1 lcl|XCV2943

1

148

S=576 I=78 E=2.84017e-63

hypothetical protein

X.species

YP_362144.1 lcl|XCV0413

60

145

S=221 I=52 E=3.78312e-20

hypothetical protein

X.species

YP_362143.1 lcl|XCV0412

1

52

S=140 I=58 E=1.98522e-10

hypothetical protein

pubmed

7

145

S=348 I=53 E=4.56158e-34

Hpa3

Pubmed 15986924

 

prodomImg

pubmed

14

139

S=346 I=57 E=7.96988e-34

Hpa3

Pubmed 16957248

 

prodomImg

Iprscan [seg]

78

91

-

Iprscan [seg]

101

111

-

PDA210P5

60

145

S=244 I=59 E=3.78424e-22

PDA0P989

1

52

S=172 I=67 E=2.26515e-13

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CtlZn1Vx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVSB6t5/XFF4834R_chr18440.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVSB6t5/XFF4834R_chr18440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVSB6t5/XFF4834R_chr18440.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVSB6t5/XFF4834R_chr18440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.