Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr18250XFF4834R_chr19530238_2087431_r3_XFF4834R-XFF4834R_chr18250XFF4834R_chr18250putative sensory protein of a two component system

XFF4834R_chr19530238_2087431_r3_XFF4834R-XFF4834R_chr18250 XFF4834R_chr18250
XFF4834R_chr18240
XFF4834R_chr18240
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18260
XFF4834R_chr18260
ID XFF4834R_chr19530238_2087431_r3_XFF4834R-XFF4834R_chr18250
AC XFF4834R_chr18250
LT XFF4834R_chr18250
OR XFF4834R_chr from 2086238 to 2087431 on strand -
DE putative sensory protein of a two component system
IP ATP-binding region, ATPase-like; Signal transduction histidine kinase/phosphatase, lantibiotic regulatory protein MprB
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: signal transduction (GO:0007165)
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Cellular Component: membrane (GO:0016020)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: signal transducer activity (GO:0004871)
Molecular Function: protein histidine kinase activity (GO:0004673)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN Starts at the same position than in ortholog Xac2804, but 6 resiudes longer than ortholog Xcv2965. Although codon usage is not good in the Nter end of the protein, there is no start codon that would permit to start the protein at the same place than Xcv2965. Start position NOT modified. Ortholog Xacx2804 is annotated baeS, but it cannot be right cos baeS is shorter in N-ter.
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101011)
MW 44394.8 Da
SQ 397 aa
 
........10........20........30........40........50
| | | | |
MKVLRRFHAWRNQAPLWWWVGLRMSALAVVTMMVIAFGMWCYFNLRYSLI
LSNVPAEPRAEISQLIEQPRANQARLWELFQRYYDIENFLPGLANPDWWM
LGAMMTISVPVILFCGLLASRPLSRQFSQVAFAAHRVSDGDFGARAQVVR
GAPDELTALADDFNTMSGRLQQYERELRDSSAMLAHELRTPLNAAMGRVQ
GMLDDVFPREPEQLRLVHRQLEQINRLIGDLHLVSLARAGQLVLEPESVE
LRELVAERIEWAGPALREAQMTIHYPTHPALRLHADRHRLGQVLSILIDN
ALRYAAAGKLLEIEVRRDGTGVQLSVGDRGPGVAPAQLPHLLDRFWRADS
SRARHSGGSGLGLAIASAICQAHDGQLVVSNRPGGGLLASVQLPLGR
XFF4834R

XFF4834R_chr03000 lcl|baeS-XFF4834R_chr03000

98

394

S=300 I=32 E=9.80999e-30

sensory histidine kinase in two-component regulatory system with BaeR

XFF4834R

XFF4834R_chr35800 lcl|XFF4834R_chr39000203_4152314_r2_XFF4834R-XFF4834R_chr35800

182

394

S=220 I=32 E=4.32411e-20

XFF4834R

XFF4834R_chr07370 lcl|XFF4834R_chr07780823_0854325_r1_XFF4834R-XFF4834R_chr07370

120

394

S=209 I=31 E=1.08869e-18

XFF4834R

XFF4834R_chr21590 lcl|XFF4834R_chr23530104_2506487_r2_XFF4834R-XFF4834R_chr21590

182

395

S=207 I=31 E=1.96964e-18

XFF4834R

XFF4834R_chr11650 lcl|XFF4834R_chr12140989_1302374_f3_XFF4834R-XFF4834R_chr11650

152

396

S=197 I=31 E=3.29175e-17

XFF4834R

XFF4834R_chr09040 lcl|XFF4834R_chr09630140_1044050_r2_XFF4834R-XFF4834R_chr09040

185

353

S=181 I=34 E=2.57442e-15

XFF4834R

XFF4834R_chr16090 lcl|XFF4834R_chr17300019_1859594_f3_XFF4834R-XFF4834R_chr16090

169

395

S=171 I=28 E=4.19142e-14

XFF4834R

XFF4834R_chr38410 lcl|XFF4834R_chr41490895_4436079_f1_XFF4834R-XFF4834R_chr38410

152

351

S=166 I=30 E=1.87776e-13

XFF4834R

XFF4834R_chr10450 lcl|phoR-XFF4834R_chr10450

169

349

S=159 I=28 E=1.25631e-12

sensory histidine kinase in two-component regulatory system with PhoB

XFF4834R

XFF4834R_chr16110 lcl|XFF4834R_chr17340755_1864378_f2_XFF4834R-XFF4834R_chr16110

182

395

S=153 I=26 E=6.64234e-12

X.species

NP_643113.1 lcl|baeS-XAC2804

1

397

S=1974 I=96 E=0

two-component system sensor protein

X.species

YP_364696.1 lcl|XCV2965

122

397

S=1301 I=93 E=2.04538e-150

putative two-component system sensor histidine kinase

X.species

lcl|baeS-XALc_1553

24

394

S=1131 I=60 E=7.70267e-130

probable two component system sensor protein

X.species

YP_362066.1 lcl|XCV0335

98

394

S=298 I=30 E=6.15782e-29

two-component system sensor protein

X.species

NP_640682.1 lcl|smeS-XAC0326

98

394

S=295 I=30 E=1.31478e-28

two-component system sensor protein

X.species

lcl|XALc_1635

182

394

S=241 I=32 E=4.88022e-22

putative two-component system sensor protein

X.species

lcl|XALc_2929

182

397

S=237 I=33 E=1.69789e-21

putative two-component system sensor-response regulator hybrid protein

X.species

YP_365535.1 lcl|XCV3804

182

394

S=220 I=32 E=1.7099e-19

two-component system sensor histidine kinase-response regulator hybrid protein

X.species

NP_643990.1 lcl|XAC3683-XAC3683

182

394

S=219 I=32 E=2.12634e-19

sensor histidine kinase

X.species

NP_638989.1 lcl|XCC3643

182

394

S=211 I=32 E=1.96423e-18

sensor histidine kinase

pubmed

133

397

S=349 I=33 E=1.74969e-33

Signal transduction histidine-protein kinase baeS EC=2.7.13.3 ; ATP-binding Cell inner membrane Nucleotide-binding Phosphoprotein Transferase Tr

Pubmed 8282725

 

prodomImg

pubmed

98

394

S=341 I=33 E=1.3226e-32

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory

Pubmed 11709330,11796339

 

prodomImg

pubmed

98

394

S=337 I=33 E=4.18069e-32

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 17263848

 

prodomImg

pubmed

72

394

S=306 I=31 E=2.4268e-28

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 17185223

 

prodomImg

pubmed

90

396

S=303 I=29 E=5.95723e-28

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 15328088

 

prodomImg

pubmed

90

355

S=302 I=31 E=6.90899e-28

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 18591275

 

prodomImg

pubmed

90

396

S=302 I=29 E=7.09209e-28

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 18591275

 

prodomImg

pubmed

90

355

S=300 I=31 E=1.52752e-27

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 18591275

 

prodomImg

pubmed

90

355

S=299 I=31 E=1.78708e-27

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 17420217

 

prodomImg

pubmed

90

355

S=299 I=31 E=1.8505e-27

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 18591275

 

prodomImg

Iprscan IPR003594 [G3DSA:3.30.565.10]

246

395

ATP-binding region, ATPase-like

Iprscan IPR003660 [PF00672]

101

172

HAMP linker domain

Iprscan IPR003661 [PF00512]

176

240

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [PF02518]

285

396

ATP-binding region, ATPase-like

Iprscan IPR003660 [SM00304]

121

175

HAMP linker domain

Iprscan IPR003661 [SM00388]

176

240

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [SM00387]

285

397

ATP-binding region, ATPase-like

Iprscan IPR005467 [PS50109]

183

397

Signal transduction histidine kinase, core

Iprscan IPR003660 [PS50885]

121

175

HAMP linker domain

Iprscan [seg]

356

369

-

Iprscan [tmhmm]

21

43

-

Iprscan [tmhmm]

98

120

-

PD651851

4

88

S=358 I=78 E=6.13275e-36

PD945612

232

294

S=200 I=67 E=8.48082e-17

PDA364G1

89

120

S=174 I=100 E=1.39053e-13

PDA29628

295

323

S=134 I=97 E=8.79973e-09

PD593836

293

352

S=130 I=42 E=2.88027e-08

PD431966

156

335

S=126 I=27 E=9.02539e-08

PDA9P6F6

149

279

S=107 I=27 E=1.57426e-05

PD515325

267

352

S=104 I=26 E=3.79764e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pBvIHzT1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

351 hits
swiss-prot

Swiss-Prot ncbi-blastp

224 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

23 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlK0deh/XFF4834R_chr18250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlK0deh/XFF4834R_chr18250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlK0deh/XFF4834R_chr18250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlK0deh/XFF4834R_chr18250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.