Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr18210XFF4834R_chr19450207_2082382_r3_XFF4834R-XFF4834R_chr18210XFF4834R_chr18210Conserved hypothetical protein

XFF4834R_chr19450207_2082382_r3_XFF4834R-XFF4834R_chr18210 XFF4834R_chr18210
XFF4834R_chr18200
XFF4834R_chr18200
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18220
XFF4834R_chr18220
ID XFF4834R_chr19450207_2082382_r3_XFF4834R-XFF4834R_chr18210
AC XFF4834R_chr18210
LT XFF4834R_chr18210
OR XFF4834R_chr from 2081207 to 2082037 on strand -
DE Conserved hypothetical protein
IP Protein of unknown function DUF72
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN start modification for alignment with other conserved proteins in xanhomonads
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110812)
MW 30429.3 Da
SQ 276 aa
 
........10........20........30........40........50
| | | | |
MTDLFASAPPALEGIHIGIGGWVYAPWRAGMFYPEGLVQRRELEYASRHV
TAIEINGTYYGTQKPATYAKWRDDVPPGFVFSAKAPRRITQSRKLAGTKA
QVEDFIGGIVELGDTLGPLVWQFEQGHRLQADDLDAFLSLLPKRAGTRAL
RHVLEIRDHDAVDASLLALVRGHGVATVVTDSDEHPSFADLSTDFVYARL
MRSQARLTAGYPAPALARWAERVQAWRRGEDPADLAHVDASAAPTRQPRE
VFVFFISAAKERNPAAAMALLKALSR
XFF4834R

XFF4834R_chr17190 XFF4834R_chr18350443_1968339_r1_XFF4834R-XFF4834R_chr17190

15

274

S=429 I=40 E=1.54323e-45

conserved hypothetical protein

XFF4834R

XFF4834R

XFF4834R_chr_0670 XFF4834R_chr_0694709_0695281_r3_XFF4834R-XFF4834R_chr_0670

11

119

S=150 I=36 E=8.66064e-12

conserved hypothetical protein (N-terminal fragment)

XFF4834R

XFF4834R

NP_643117.1 XAC2808-XAC2808

1

275

S=1392 I=97 E=1.13425e-161

hypothetical protein

xanac

XFF4834R

YP_364700.1 XCV2969

1

275

S=1382 I=96 E=1.64878e-160

hypothetical protein

xanc5

XFF4834R

NP_637986.1 XCC2638

1

264

S=1215 I=88 E=3.43202e-140

hypothetical protein

xancp

XFF4834R

NP_638100.1 XCC2752

15

274

S=466 I=39 E=2.00383e-49

hypothetical protein

xancp

XFF4834R

YP_364796.1 XCV3065

15

274

S=426 I=40 E=1.34789e-44

hypothetical protein

xanc5

XFF4834R

NP_643229.1 XAC2920-XAC2920

15

274

S=416 I=40 E=2.1009e-43

hypothetical protein

xanac

XFF4834R

NP_640958.1 XAC0605-XAC0605

11

123

S=158 I=36 E=3.24972e-12

hypothetical protein

xanac

XFF4834R

NP_638874.1 XCC3528

15

144

S=158 I=32 E=3.27818e-12

hypothetical protein

xancp

XFF4834R

YP_362392.1 XCV0661

11

123

S=156 I=36 E=6.93861e-12

hypothetical protein

xanc5

pubmed

17

223

S=158 I=31 E=1.63989e-10

Putative uncharacterized protein

Pubmed 14617179

 

prodomImg

Iprscan IPR002763 [G3DSA:3.20.20.410]

15

274

Protein of unknown function DUF72

Iprscan IPR002763 [PF01904]

32

274

Protein of unknown function DUF72

PD117970

43

131

S=207 I=44 E=1.13292e-17

PD472783

190

267

S=155 I=46 E=2.67231e-11

PDA1G4W4

129

189

S=118 I=44 E=7.4515e-07

PDA5J7V9

15

81

S=107 I=36 E=1.61763e-05

PDA1G4O0

15

40

S=102 I=73 E=6.3034e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one bEyWKYUz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBC_T1lT/XFF4834R_chr18210.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBC_T1lT/XFF4834R_chr18210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBC_T1lT/XFF4834R_chr18210.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBC_T1lT/XFF4834R_chr18210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.