Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr17830zurXFF4834R_chr17830zinc uptake regulator

zur XFF4834R_chr17830
XFF4834R_chr17820
XFF4834R_chr17820
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17840
XFF4834R_chr17840
ID zur
AC XFF4834R_chr17830
LT XFF4834R_chr17830
OR XFF4834R_chr from 2038642 to 2039148 on strand +
DE zinc uptake regulator
IP Ferric-uptake regulator
CL 3.1.2 Transcriptional level GO:0006355
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100722)
MW 18303.7 Da
SQ 168 aa
 
........10........20........30........40........50
| | | | |
MTKHTHAPDLACTAPHHHVDDANGFVRAVERACSERGLRLTPIRANVLRL
IADAGKPVKAYELLDWVREGKGVGADAPPTVYRALDFLMANGFVHKLESV
NAFVACHHPNSAQHSVPFLICDRCHSAVELEDRDVVSQLEARAKALGFQP
QAQTLEVHGLCAKCAVAE
X.species

YP_364737.1 lcl|zur-XCV3006

1

168

S=885 I=100 E=1.44399e-100

zinc uptake regulator

X.species

NP_643155.1 lcl|XAC2846-XAC2846

1

168

S=885 I=100 E=1.44399e-100

FUR family transcriptional regulator

X.species

NP_638033.1 lcl|XCC2685

1

167

S=830 I=94 E=5.8481e-94

FUR family transcriptional regulator

X.species

lcl|zur-XALc_2061

11

165

S=679 I=83 E=1.35383e-75

probable zinc uptake regulator protein

pubmed

1

168

S=866 I=98 E=9.40911e-97

Zur

Pubmed 17375359

 

prodomImg

pubmed

1

167

S=830 I=94 E=2.14692e-92

Transcriptional regulator fur family Zinc-dependent zinc-uptake regulatory protein Zur

Pubmed 16042011

 

prodomImg

pubmed

30

168

S=293 I=43 E=2.73516e-27

Zinc uptake regulation protein ; DNA-binding Repressor Transcription

Pubmed 8265357

 

prodomImg

pubmed

33

120

S=205 I=49 E=1.40931e-16

Np20

Pubmed 8816818

 

prodomImg

pubmed

34

167

S=123 I=26 E=1.24783e-06

Ferric uptake regulator

Pubmed 11164306

 

prodomImg

sp

30

168

S=293 I=43 E=1.88231e-27

Zinc uptake regulation protein ; DNA-binding Repressor Transcription

 

prodomImg

sp

30

168

S=293 I=43 E=1.88231e-27

Zinc uptake regulation protein ; DNA-binding Repressor Transcription

 

prodomImg

Iprscan IPR002481 [PF01475]

35

157

Ferric-uptake regulator

PD599746

9

39

S=156 I=97 E=2.00596e-11

PDA8E526

25

112

S=136 I=32 E=5.41076e-09

PD924720

40

97

S=129 I=47 E=3.98444e-08

PDA7L7C1

98

165

S=117 I=32 E=1.11381e-06

PDA76045

99

164

S=115 I=36 E=1.63463e-06

Iprscan [SSF46785]

27

163

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 48JXHxqF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcijVkQ/XFF4834R_chr17830.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcijVkQ/XFF4834R_chr17830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcijVkQ/XFF4834R_chr17830.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcijVkQ/XFF4834R_chr17830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.