Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr17160pilUXFF4834R_chr17160twitching motility protein PilU

pilU XFF4834R_chr17160
XFF4834R_chr17150
XFF4834R_chr17150
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17170
XFF4834R_chr17170
ID pilU
AC XFF4834R_chr17160
LT XFF4834R_chr17160
OR XFF4834R_chr from 1964962 to 1966092 on strand +
DE twitching motility protein PilU
IP Type II secretion system protein E
CL 1.6.13 Fimbria, pili, curli GO:0009297
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: intracellular (GO:0005622)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: acur
CC STATUS: curated by poussier (20100510)
MW 42043.9 Da
SQ 376 aa
 
........10........20........30........40........50
| | | | |
MSTIDFTSFLKLMAHQKASDLFITSGMPPAIKVHGKISPITQTPLTAQQS
RDLVLNVMTPSQREEFEKTHECNFAIGVSGVGRFRVSCFYQRNQVGMVLR
RIETRIPTVDELSLPPVIKTLSMTKRGIIIFVGATGTGKSTSLAAMIGYR
NQNSTGHIITIEDPIEFVHKHEGCIITQREVGIDTDSWENALKNTLRQAP
DVIMIGEVRTREGMDHAIAFAETGHLVLCTLHANNANQAMDRIINFFPED
RRNQLLMDLSLNLKGVVAQQLIPTPDGRSRRVAMEIMLGTPLVQDYIRDG
EIHKLKEIMKESTNLGMRTFDQSLFELYQAGEISYEDALRYADSQNEVRL
RIKLSQGGDAKTLSQGLDGVEISEVR
XFF4834R

XFF4834R_chr35010 lcl|XFF4834R_chr_4063490_4064623_f2_XFF4834R-XFF4834R_chr35010

4

361

S=1008 I=51 E=1.39766e-115

XFF4834R

XFF4834R_chr17150 lcl|XFF4834R_chr18310812_1964849_f3_XFF4834R-XFF4834R_chr17150

4

345

S=665 I=39 E=5.89455e-74

predicted transporter

XFF4834R

XFF4834R_chr34380 lcl|XFF4834R_chr37340472_3974199_r1_XFF4834R-XFF4834R_chr34380

114

272

S=239 I=40 E=1.96528e-22

XFF4834R

XFF4834R_chr07050 lcl|gspE-XFF4834R_chr07050

84

272

S=224 I=34 E=1.34859e-20

general secretory pathway component, cryptic

XFF4834R

XFF4834R_chr14000 lcl|hofB-XFF4834R_chr14000

127

246

S=210 I=39 E=7.31306e-19

conserved protein with nucleoside triphosphate hydrolase domain

XFF4834R

XFF4834R_chr40840 lcl|XFF4834R_chr_4728446_4730260_f2_XFF4834R-XFF4834R_chr40840

127

274

S=208 I=36 E=1.31158e-18

XFF4834R

XFF4834R_chr26490 lcl|XFF4834R_chr_3060268_3061326_r1_XFF4834R-XFF4834R_chr26490

118

243

S=98 I=25 E=2.5611e-05

XFF4834R

XFF4834R_chr35010 lcl|XFF4834R_chr_4063490_4064623_f2_XFF4834R-XFF4834R_chr35010

4

361

S=1008 I=51 E=1.39766e-115

X.species

NP_643232.1 lcl|pilU-XAC2923

1

376

S=2012 I=100 E=0

twitching motility protein

X.species

YP_364798.1 lcl|pilU-XCV3067

1

376

S=2005 I=100 E=0

Tfp pilus assembly protein ATPase

X.species

NP_638102.1 lcl|pilU-XCC2754

1

376

S=1995 I=99 E=0

twitching motility protein

X.species

lcl|pilU-XALc_2159

1

376

S=1927 I=94 E=0

probable type iv pilus assembly protein atpase pilu

X.species

NP_635985.1 lcl|uptC-XCC0593

4

361

S=1014 I=51 E=1.08079e-115

type II secretion system protein-like protein

X.species

NP_643914.1 lcl|uptC-XAC3607

4

361

S=1008 I=51 E=5.28306e-115

type II secretion system protein-like protein

X.species

YP_365461.1 lcl|XCV3730

4

361

S=1007 I=51 E=6.51271e-115

Tfp pilus assembly protein

X.species

lcl|XALc_2717

4

361

S=992 I=50 E=4.6682e-113

hypothetical protein

X.species

YP_364799.1 lcl|XCV3068

4

345

S=665 I=39 E=1.82325e-73

Tfp pilus assembly protein, putative ATPase

X.species

NP_638103.1 lcl|pilT-XCC2755

4

345

S=665 I=39 E=1.82325e-73

twitching motility protein

pubmed

4

374

S=1383 I=66 E=8.31131e-159

Twitching motility protein PilU PilU protein ; ATP-binding Nucleotide-binding

Pubmed 1676385,7854122

 

prodomImg

pubmed

4

374

S=1369 I=66 E=3.92017e-157

Putative secretion protein ; ATP-binding Nucleotide-binding

Pubmed 11466271

 

prodomImg

pubmed

38

328

S=1231 I=75 E=1.8908e-140

PilU

Pubmed 16000795

 

prodomImg

pubmed

38

327

S=1224 I=74 E=1.40457e-139

PilU

Pubmed 16000795

 

prodomImg

pubmed

38

328

S=1222 I=74 E=2.32894e-139

PilU

Pubmed 16000795

 

prodomImg

pubmed

38

328

S=1218 I=74 E=8.61261e-139

PilU

Pubmed 16000795

 

prodomImg

pubmed

38

328

S=1217 I=74 E=1.13842e-138

PilU

Pubmed 16000795

 

prodomImg

pubmed

38

328

S=1216 I=74 E=1.15845e-138

PilU

Pubmed 16000795

 

prodomImg

pubmed

38

324

S=1214 I=75 E=2.24725e-138

PilU

Pubmed 16000795

 

prodomImg

pubmed

42

328

S=1214 I=75 E=2.47344e-138

PilU

Pubmed 16000795

 

prodomImg

sp

4

338

S=683 I=41 E=3.13222e-74

Twitching mobility protein ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

 

prodomImg

sp

8

344

S=598 I=37 E=6.34919e-64

Twitching motility protein ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

 

prodomImg

sp

4

323

S=553 I=34 E=1.73836e-58

Uncharacterized protein yggR ; ATP-binding Nucleotide-binding Transport

 

prodomImg

sp

114

272

S=240 I=40 E=1.59823e-20

General secretion pathway protein E ; ATP-binding Cytoplasm Nucleotide-binding Transport

 

prodomImg

sp

84

246

S=237 I=35 E=3.53355e-20

ComG operon protein 1 ; ATP-binding Cell membrane Competence Nucleotide-binding Transport

 

prodomImg

PD098282

31

118

S=218 I=51 E=7.44405e-19

PDA1K6W6

337

376

S=167 I=83 E=9.29143e-13

PDA5B563

117

203

S=142 I=37 E=1.00247e-09

PDA1K6X0

1

30

S=141 I=87 E=1.61931e-09

PDA1G3B1

248

286

S=138 I=64 E=3.22452e-09

PD779503

196

282

S=137 I=31 E=4.53042e-09

PD006813

287

336

S=129 I=45 E=4.33354e-08

PD000739

126

203

S=128 I=36 E=5.0259e-08

PDA1X4K8

246

340

S=112 I=32 E=4.40241e-06

PD642137

126

247

S=107 I=27 E=1.67119e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one EU8Tt2x0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

193 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_Twv6N/XFF4834R_chr17160.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_Twv6N/XFF4834R_chr17160.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_Twv6N/XFF4834R_chr17160.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_Twv6N/XFF4834R_chr17160.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.