Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr17150pilTXFF4834R_chr17150probable twitching motility protein pilT

pilT XFF4834R_chr17150
XFF4834R_chr_1838
XFF4834R_chr_1838
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17160
XFF4834R_chr17160
ID pilT
AC XFF4834R_chr17150
LT XFF4834R_chr17150
OR XFF4834R_chr from 1963812 to 1964849 on strand +
DE probable twitching motility protein pilT
IP Type II secretion system protein E
CL 1.6.13 Fimbria, pili, curli GO:0009297
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: intracellular (GO:0005622)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: nucleotide binding (GO:0000166)

Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100510)
MW 38623.9 Da
SQ 345 aa
 
........10........20........30........40........50
| | | | |
MDIAELLAFSVKNKASDLHLSAGLPPMIRVDGDVRRINIPALDHKQVHAL
VYDIMSDKQRRDYEEFLEVDFSFEIPSLARFRVNAFNQNRGAGAVFRTIP
SEVLTLEDLGCPPIFRQLIDQPQGLILVTGPTGSGKSTTLAGMIDYINKN
EYGHILTVEDPIEFVHTSQKCLINQREVHRDTHGFNEALRSALREDPDII
LVGELRDLETIRLALTAAETGHLVFGTLHTSSAAKTIDRIIDVFPAGEKP
MVRSMLSESLRAVISQALLKKVGGGRTAAWEIMVGTPAIRNLIREDKVAQ
MYSSIQTGQQYGMQTLDQHLQDLVKRSLITRNQAHEYAKDKRIFE
XFF4834R

XFF4834R_chr35010 lcl|XFF4834R_chr_4063490_4064623_f2_XFF4834R-XFF4834R_chr35010

1

342

S=707 I=42 E=3.71603e-79

XFF4834R

XFF4834R_chr17160 lcl|XFF4834R_chr18320962_1966092_f1_XFF4834R-XFF4834R_chr17160

1

341

S=665 I=39 E=5.33703e-74

XFF4834R

XFF4834R_chr34380 lcl|XFF4834R_chr37340472_3974199_r1_XFF4834R-XFF4834R_chr34380

81

272

S=317 I=38 E=7.83104e-32

XFF4834R

XFF4834R_chr07050 lcl|gspE-XFF4834R_chr07050

81

305

S=305 I=34 E=1.8388e-30

general secretory pathway component, cryptic

XFF4834R

XFF4834R_chr14000 lcl|hofB-XFF4834R_chr14000

3

272

S=286 I=32 E=3.98848e-28

conserved protein with nucleoside triphosphate hydrolase domain

XFF4834R

XFF4834R_chr40840 lcl|XFF4834R_chr_4728446_4730260_f2_XFF4834R-XFF4834R_chr40840

105

243

S=281 I=42 E=1.78684e-27

XFF4834R

XFF4834R_chr35010 lcl|XFF4834R_chr_4063490_4064623_f2_XFF4834R-XFF4834R_chr35010

1

342

S=707 I=42 E=3.71603e-79

XFF4834R

XFF4834R_chr17160 lcl|XFF4834R_chr18320962_1966092_f1_XFF4834R-XFF4834R_chr17160

1

341

S=665 I=39 E=5.33703e-74

X.species

YP_364799.1 lcl|XCV3068

1

345

S=1827 I=100 E=0

Tfp pilus assembly protein, putative ATPase

X.species

NP_638103.1 lcl|pilT-XCC2755

1

345

S=1827 I=100 E=0

twitching motility protein

X.species

NP_643233.1 lcl|pilT-XAC2924

1

345

S=1827 I=100 E=0

twitching motility protein

X.species

lcl|pilT-XALc_2160

1

345

S=1799 I=98 E=0

putative type iv pilus assembly protein, pilus retraction atpase pilt

X.species

YP_365461.1 lcl|XCV3730

1

342

S=708 I=42 E=1.25042e-78

Tfp pilus assembly protein

X.species

NP_643914.1 lcl|uptC-XAC3607

1

342

S=707 I=42 E=1.4005e-78

type II secretion system protein-like protein

X.species

lcl|XALc_2717

1

334

S=695 I=42 E=3.78077e-77

hypothetical protein

X.species

NP_635985.1 lcl|uptC-XCC0593

1

342

S=694 I=41 E=5.08536e-77

type II secretion system protein-like protein

X.species

NP_638102.1 lcl|pilU-XCC2754

1

341

S=676 I=39 E=9.10526e-75

twitching motility protein

X.species

YP_364798.1 lcl|pilU-XCV3067

1

341

S=671 I=39 E=3.19557e-74

Tfp pilus assembly protein ATPase

pubmed

1

344

S=1479 I=79 E=1.70798e-170

Twitching motility protein ; ATP-binding Nucleotide-binding

Pubmed 11466271

 

prodomImg

pubmed

1

339

S=1451 I=79 E=4.00379e-167

Twitching mobility protein ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

Pubmed 1676385

 

prodomImg

pubmed

1

340

S=1385 I=75 E=3.80748e-159

TapT Type IV pilus protein TapT ; ATP-binding Nucleotide-binding

Pubmed 18212071

 

prodomImg

pubmed

1

340

S=1191 I=66 E=1.28819e-135

Twitching motility protein PilT ; ATP-binding Nucleotide-binding

Pubmed 16645985

 

prodomImg

pubmed

1

340

S=1191 I=66 E=1.28819e-135

PilT ; ATP-binding Nucleotide-binding

Pubmed 10097155

 

prodomImg

pubmed

1

340

S=1190 I=65 E=1.48103e-135

PilT ; ATP-binding Nucleotide-binding

Pubmed 8188352

 

prodomImg

pubmed

26

341

S=1097 I=65 E=3.38906e-124

Twitching motility protein ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

Pubmed 8100347

 

prodomImg

pubmed

2

340

S=922 I=53 E=4.59794e-103

PilT

Pubmed 9004225

 

prodomImg

pubmed

2

344

S=886 I=53 E=1.05832e-98

PilT ; ATP-binding Nucleotide-binding

Pubmed 11823215

 

prodomImg

pubmed

3

341

S=868 I=52 E=1.96216e-96

PilT-like protein ; ATP-binding Nucleotide-binding

Pubmed 11844780

 

prodomImg

sp

1

339

S=1451 I=79 E=2.75669e-167

Twitching mobility protein ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

 

prodomImg

sp

26

341

S=1097 I=65 E=2.33344e-124

Twitching motility protein ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

 

prodomImg

sp

1

324

S=764 I=49 E=4.19112e-84

Uncharacterized protein yggR ; ATP-binding Nucleotide-binding Transport

 

prodomImg

sp

3

272

S=339 I=39 E=1.43438e-32

General secretion pathway protein E ; ATP-binding Cytoplasm Nucleotide-binding Transport

 

prodomImg

sp

3

272

S=328 I=37 E=2.80454e-31

General secretion pathway protein E ; ATP-binding Cytoplasm Nucleotide-binding Transport

 

prodomImg

PD098282

27

115

S=253 I=52 E=3.69453e-23

PD000739

121

200

S=198 I=50 E=1.42001e-16

PD002760

199

276

S=166 I=49 E=1.04307e-12

PDA2F5Z5

5

304

S=157 I=20 E=1.37759e-11

PD006813

283

330

S=155 I=63 E=2.89049e-11

PDA5B563

124

200

S=136 I=39 E=5.13045e-09

PDA1G3H0

1

26

S=127 I=96 E=7.01629e-08

PD779503

191

281

S=115 I=34 E=1.67647e-06

PD980392

259

341

S=112 I=32 E=3.80475e-06

PDA054J5

118

244

S=110 I=33 E=7.31669e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BYbFQhA6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

199 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

7 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7kmdyU/XFF4834R_chr17150.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7kmdyU/XFF4834R_chr17150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7kmdyU/XFF4834R_chr17150.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7kmdyU/XFF4834R_chr17150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.