Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr16840XFF4834R_chr18030822_1935028_f2_acur-XFF4834R_chr16840XFF4834R_chr16840conserved hypothetical protein

XFF4834R_chr18030822_1935028_f2_acur-XFF4834R_chr16840 XFF4834R_chr16840
XFF4834R_chr_1803
XFF4834R_chr_1803
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16850
XFF4834R_chr16850
ID XFF4834R_chr18030822_1935028_f2_acur-XFF4834R_chr16840
AC XFF4834R_chr16840
LT XFF4834R_chr16840
OR XFF4834R_chr from 1934822 to 1935028 on strand +
DE conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN Hits blastx ncbi pour hypothetical protein
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by bonneau (20100902)
MW 7062 Da
SQ 68 aa
 
........10........20........30........40........50
| | | | |
MGGKRPVGLVGTQSFQQAISTGDTAYSLFNKTISKLSGAVSSPIAGPLAA
WMPPSSPHGRVYGVSRER
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr24690 XFF4834R_chr27000144_2849503_f2_acur-XFF4834R_chr24690

27

68

S=165 I=79 E=1.34288e-14

PDA6I707

17

68

S=163 I=62 E=2.39918e-12

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one AToDYLqD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBI_7JJk/XFF4834R_chr16840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBI_7JJk/XFF4834R_chr16840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBI_7JJk/XFF4834R_chr16840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBI_7JJk/XFF4834R_chr16840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.