Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr16690lptAXFF4834R_chr16690Probable lipopolysaccharide export system protein LptA, chaperone periplasm signal transport

lptA XFF4834R_chr16690
XFF4834R_chr16680
XFF4834R_chr16680
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16700
XFF4834R_chr16700
ID lptA
AC XFF4834R_chr16690
LT XFF4834R_chr16690
OR XFF4834R_chr from 1922758 to 1923318 on strand -
DE Probable lipopolysaccharide export system protein LptA, chaperone periplasm signal transport
IP Lipopolysccharide-assembly, LptA
CL 4.3.A.1.p periplasmic binding component
EC
GO InterPro


Curated
PM
AN 1 dom interpro pour LipoPS assembly LptA de 22 a 161 aa sur 186 aa ; 1 preuve fonctionnelle chez E coli dans article J Bacteriol 2007 de Sperandeo (PMID 17056748) avec genes yhbN et yhbG respectivement renommes LptA et LptB et avec hit E coli pour LptA : I=34% ; PCS=75% et PCQ= 75% ; LptA requis pour la biogenese des LPS, la translocation des LPS de la membrane interne a la membrane externe ; peut agir comme chaperone qui facilite transfert LPS a travers periplasme.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20121119)
MW 19687.2 Da
SQ 186 aa
 
........10........20........30........40........50
| | | | |
MNRMLPAKLAFAALLLPALAMAKTSDRNQPMAIDSNANDCNMLDDSGKCR
FSGNVVITQGTLEIHADTADIFQKNGQTDRVVLNGKQATLKQEMDDGATM
HGQADNIEYKVADEIIILTGNYKVDSPKGTNAGQRMVYNTKTGNMQSGGD
GSRVRTVIQPKNAAPAAATPAATPAAKPAAKPQGKK
Show or not Domain decomposition
 
X.species

NP_643279.1 XAC2970-XAC2970

24

162

S=731 I=99 E=6.90918e-82

hypothetical protein

X.species

YP_364847.1 XCV3116

24

162

S=726 I=99 E=3.17735e-81

putative secreted protein

X.species

NP_638148.1 XCC2800

24

159

S=686 I=96 E=2.02833e-76

hypothetical protein

X.species

XALc_2138 XALc_2138

24

162

S=547 I=73 E=1.62218e-59

putative osta-like protein

pubmed

70

162

S=477 I=98 E=1.65588e-49

Pv. vesicatoria ORF1

Pubmed 8969534

 

prodomImg

pubmed

24

160

S=196 I=34 E=1.98415e-15

Lipopolysaccharide export system protein lptA ; Chaperone Periplasm Signal Transport

Pubmed 7876255

 

prodomImg

pubmed

26

160

S=164 I=32 E=1.35926e-11

Lipopolysaccharide export system protein lptA ; Chaperone Periplasm Signal Transport

Pubmed 10675023

 

prodomImg

sp

24

160

S=196 I=34 E=1.36055e-15

Lipopolysaccharide export system protein lptA ; Chaperone Periplasm Signal Transport

 

prodomImg

sp

24

160

S=196 I=34 E=1.36055e-15

Lipopolysaccharide export system protein lptA ; Chaperone Periplasm Signal Transport

 

prodomImg

sp

24

160

S=196 I=34 E=1.36055e-15

Lipopolysaccharide export system protein lptA ; Chaperone Periplasm Signal Transport

 

prodomImg

sp

24

160

S=196 I=34 E=1.36055e-15

Lipopolysaccharide export system protein lptA ; Chaperone Periplasm Signal Transport

 

prodomImg

sp

26

160

S=164 I=32 E=9.3206e-12

Lipopolysaccharide export system protein lptA ; Chaperone Periplasm Signal Transport

 

prodomImg

Iprscan IPR005653 [PF03968]

8

143

Organic solvent tolerance-like, N-terminal

Iprscan IPR014340 [TIGR03002]

22

161

Lipopolysccharide-assembly, LptA

Iprscan [seg]

4

23

-

Iprscan [seg]

163

182

-

Iprscan [SignalP-NN(euk)]

1

22

-

PDA1K825

24

61

S=164 I=82 E=2.1729e-12

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one TOsIeL6p)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGGnsy7/XFF4834R_chr16690.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGGnsy7/XFF4834R_chr16690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGGnsy7/XFF4834R_chr16690.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGGnsy7/XFF4834R_chr16690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.