Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr16680lptBXFF4834R_chr16680putative ABC transporter ATP-binding protein LptB

lptB XFF4834R_chr16680
XFF4834R_chr16670
XFF4834R_chr16670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16690
XFF4834R_chr16690
ID lptB
AC XFF4834R_chr16680
LT XFF4834R_chr16680
OR XFF4834R_chr from 1922039 to 1922758 on strand -
DE putative ABC transporter ATP-binding protein LptB
IP ABC transporter-like
CL 4.3.A.1 The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases GO:0042626
EC
GO InterPro
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: ATPase activity (GO:0016887)

Curated
PM
AN Part of the ABC transporter complex LptBFG involved in the translocation of lipopolysaccharide (LPS) from the inner membrane to the outer membrane. Probably responsible for energy coupling to the transport system.
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20121119)
MW 26229.1 Da
SQ 239 aa
 
........10........20........30........40........50
| | | | |
MLVATGLRKKYKQREVVREFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGL
VEADAGRIELDGRDLTAEPMYARAKLGVGYLPQEPSIFRKLTVADNIRLV
LELREELDNAGREKELVSLLEELQITHVADQLGASLSGGERRRCEIARAL
AAKPRMMLLDEPFAGVDPISVGEIQRIIIHLKERGIGVLITDHNVRETLG
ICDRAYILAEGGVLAQGAPDTLLANPDVRRVYLGETFRL
XFF4834R

XFF4834R_chr39200 lcl|XFF4834R_chr42420275_4517021_r2_XFF4834R-XFF4834R_chr39200

1

222

S=301 I=33 E=4.22664e-30

XFF4834R

XFF4834R_chr42240 lcl|XFF4834R_chr_4911550_4912344_f1_XFF4834R-XFF4834R_chr42240

5

227

S=300 I=33 E=4.49263e-30

predicted toluene transporter subunit: ATP-binding component of ABC superfamily

XFF4834R

XFF4834R_chr35970 lcl|XFF4834R_chr_4164978_4166057_r2_XFF4834R-XFF4834R_chr35970

6

211

S=287 I=34 E=2.17518e-28

XFF4834R

XFF4834R_chr10260 lcl|cysA-XFF4834R_chr10260

7

232

S=273 I=33 E=9.16023e-27

sulfate/thiosulfate transporter subunit

XFF4834R

XFF4834R_chr34660 lcl|XFF4834R_chr37770977_4021813_f2_XFF4834R-XFF4834R_chr34660

6

219

S=263 I=33 E=1.49138e-25

XFF4834R

XFF4834R_chr08530 lcl|XFF4834R_chr09110803_0990561_r1_XFF4834R-XFF4834R_chr08530

9

208

S=260 I=32 E=3.29731e-25

XFF4834R

XFF4834R_chr_2608 lcl|potG-XFF4834R_chr_2608

7

222

S=252 I=29 E=2.99327e-24

putrescine transporter subunit: ATP-binding component of ABC superfamily

XFF4834R

XFF4834R_chr39320 lcl|XFF4834R_chr42540168_4530163_f2_XFF4834R-XFF4834R_chr39320

7

228

S=240 I=32 E=8.3674e-23

predicted transporter subunit: ATP-binding component of ABC superfamily

XFF4834R

XFF4834R_chr00720 lcl|XFF4834R_chr00730386_0086123_r2_XFF4834R-XFF4834R_chr00720

1

226

S=240 I=31 E=9.37163e-23

predicted transporter subunit: ATP-binding component of ABC superfamily

XFF4834R

XFF4834R_chr29400 lcl|pstB-XFF4834R_chr29400

2

226

S=236 I=29 E=2.53207e-22

phosphate transporter subunit

X.species

YP_364848.1 lcl|XCV3117

1

239

S=1214 I=100 E=3.36302e-140

ABC transporter ATP-binding protein

X.species

NP_643280.1 lcl|yhbG-XAC2971

1

239

S=1211 I=99 E=7.18051e-140

ABC transporter ATP-binding protein

X.species

NP_638149.1 lcl|yhbG-XCC2801

1

239

S=1166 I=95 E=2.05357e-134

ABC transporter ATP-binding protein

X.species

lcl|XALc_2139

1

239

S=1093 I=88 E=1.58284e-125

probable abc transporter atp-binding protein

X.species

lcl|natA-XALc_3005

1

224

S=321 I=36 E=5.60827e-32

probable na+ extrusion abc transporter atp-binding protein

X.species

NP_639541.1 lcl|yrbF-XCC4207

5

227

S=309 I=35 E=1.71056e-30

toluene tolerance protein

X.species

YP_365875.1 lcl|natA-XCV4144

1

224

S=308 I=34 E=2.03643e-30

Na+ extrusion ABC transporter ATP-binding protein

X.species

lcl|XALc_0027

5

227

S=307 I=34 E=2.59951e-30

probable abc transporter atp-binding protein

X.species

YP_366181.1 lcl|XCV4450

5

227

S=306 I=35 E=3.81502e-30

ABC transporter ATP-binding protein

X.species

NP_644633.1 lcl|yrbF-XAC4339

5

227

S=300 I=34 E=1.88117e-29

toluene tolerance protein

pubmed

1

239

S=1214 I=100 E=1.22677e-138

Pv. vesicatoria ORF1 ; ATP-binding Nucleotide-binding

Pubmed 8969534

 

prodomImg

pubmed

1

239

S=806 I=63 E=3.09951e-89

Putative uncharacterized protein ; ATP-binding Nucleotide-binding

Pubmed 9687481

 

prodomImg

pubmed

2

239

S=780 I=65 E=4.195e-86

Probable ABC transporter ATP-binding protein AZC_3926 ; Nucleotide-binding

Pubmed 8471796

 

prodomImg

pubmed

1

239

S=768 I=60 E=1.36003e-84

Putative ABC transporter ATP-binding protein ; Nucleotide-binding

Pubmed 9632254

 

prodomImg

pubmed

1

239

S=755 I=58 E=4.40923e-83

Lipopolysaccharide export system ATP-binding protein lptB EC=3.6.3.- ; Cell inner membrane Cytoplasm Hydrolase Nucleotide-binding Transport

Pubmed 10675023

 

prodomImg

pubmed

2

239

S=752 I=63 E=1.09184e-82

Uncharacterized ABC transporter ATP-binding protein R00382 ; Nucleotide-binding

Pubmed 2703463

 

prodomImg

pubmed

2

239

S=737 I=62 E=7.49229e-81

Orf 5' of rpoN ; ATP-binding Nucleotide-binding

Pubmed 1936948

 

prodomImg

pubmed

2

239

S=730 I=60 E=6.0199e-80

Lipopolysaccharide export system ATP-binding protein lptB EC=3.6.3.- ; Cell inner membrane Cytoplasm Hydrolase Nucleotide-binding Transport

Pubmed 8444818,7876255

 

prodomImg

pubmed

2

239

S=692 I=58 E=2.23821e-75

ABC-type unclassified transport system ATPase component ; ATP-binding Nucleotide-binding

Pubmed 18028413

 

prodomImg

pubmed

1

239

S=682 I=60 E=3.36902e-74

Lipopolysaccharide export system ATP-binding protein lptB EC=3.6.3.- ; Cell inner membrane Cytoplasm Hydrolase Nucleotide-binding Transport

Pubmed 2198257

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

1

239

-

Iprscan IPR003439 [PF00005]

27

211

ABC transporter-like

Iprscan IPR003593 [SM00382]

26

229

ATPase, AAA+ type, core

Iprscan IPR003439 [PS50893]

2

235

ABC transporter-like

PDA956Q7

19

161

S=145 I=30 E=3.93586e-10

PDA6L0Q0

181

239

S=141 I=41 E=1.1807e-09

PD145750

78

217

S=139 I=31 E=2.23128e-09

PD389701

7

66

S=122 I=43 E=3.02243e-07

PDA1Q7N2

106

135

S=120 I=83 E=4.79779e-07

PD738128

30

179

S=111 I=24 E=5.2305e-06

PD734566

137

190

S=109 I=37 E=8.74878e-06

PD507594

136

209

S=109 I=39 E=1.0325e-05

PDA332S8

2

64

S=107 I=41 E=1.81976e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one mBemcxbO)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

44 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdsN051/XFF4834R_chr16680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdsN051/XFF4834R_chr16680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdsN051/XFF4834R_chr16680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdsN051/XFF4834R_chr16680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.