Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr16300XFF4834R_chr17570003_1885152_r1_acur-XFF4834R_chr16300XFF4834R_chr16300hypothetical protein

XFF4834R_chr17570003_1885152_r1_acur-XFF4834R_chr16300 XFF4834R_chr16300
XFF4834R_chr16290
XFF4834R_chr16290
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16310
XFF4834R_chr16310
ID XFF4834R_chr17570003_1885152_r1_acur-XFF4834R_chr16300
AC XFF4834R_chr16300
LT XFF4834R_chr16300
OR XFF4834R_chr from 1885003 to 1885152 on strand -
DE hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN frame D ne retrouve aucun ORF entre 1885003 et 1885152 quelque soit les parametres ; usage du code moyen MAIS 1 blastx ncbi pour 1 hypoth protein chez X camp de 52aa avec I=87% et coverage = 98% . Si l on effectue un tBlastn avec la sequence de XopE1, on obtient un similarite avec cette ORF. Cette ORF pourrait correspondre a une version degeneree de la partie N-terminale de XopE1, aa 1 a 63. Ceci est particulierement interessant si l on observe que l ORF directement en aval correspond a XopJ5. De la meme maniere, un tBlastn de XopE2 matche aussi avec cette sequence
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by boureau (20110706)
MW 5031.6 Da
SQ 49 aa
 
........10........20........30........40........50
| | | | |
MPEGPADVPERARLARGEPSAAKSCRLGDMDASGDEGLEEVVCAVALFG
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Ffz61wbp)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdtlctX/XFF4834R_chr16300.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdtlctX/XFF4834R_chr16300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdtlctX/XFF4834R_chr16300.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdtlctX/XFF4834R_chr16300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.