Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr16090XFF4834R_chr17300019_1859594_f3_XFF4834R-XFF4834R_chr16090XFF4834R_chr16090putative two-component system sensor histidine kinase-response regulator hybrid protein

XFF4834R_chr17300019_1859594_f3_XFF4834R-XFF4834R_chr16090 XFF4834R_chr16090
XFF4834R_chr16080
XFF4834R_chr16080
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16100
XFF4834R_chr16100
ID XFF4834R_chr17300019_1859594_f3_XFF4834R-XFF4834R_chr16090
AC XFF4834R_chr16090
LT XFF4834R_chr16090
OR XFF4834R_chr from 1856019 to 1859594 on strand +
DE putative two-component system sensor histidine kinase-response regulator hybrid protein
IP Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region; Two component regulator three Y; Signal transduction histidine kinase, hybrid-type, BC3207, predicted
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
Biological Process: signal transduction (GO:0007165)
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Cellular Component: membrane (GO:0016020)
DNA-dependent (GO:0006355)
Molecular Function: two-component response regulator activity (GO:0000156)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: protein histidine kinase activity (GO:0004673)

Curated
PM
AN Nter half of the protein is recognized by BLAST on NCBI as being COG3292: Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms]
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101009)
MW 129494.7 Da
SQ 1191 aa
 
........10........20........30........40........50
| | | | |
MRVLIVVLAVLLAIWPCAAKIPEVPRFRIVGPSEGLPSTMVVAISQDRAG
YLWLGTLDGLVRYDGAGFRTWRHDPADPGSLPCNAVQALHIDALDRVWVG
CGKTLSVLDAARGRFRHYRAADYPLLKDGEIFSIAAFDGGIWAGTTTGAL
VRIDASGGMSSVDLGGIEGALDQAMVMNLAVDNQHRLWIGTSNGLAYYDG
KQLHRQYIADEPNRQSSIFGLQWTGDRLWLGSESGLHVLRADGHWQPLAW
STMFGNGNEFWGAVATPDGEFWLGSGRGLWRTRGERPPVPALSGEGPLSR
RNVVGLMGAADGGLWVPMHGTGLGYLPADWKRSAVLKPAVPMGDAIYCNL
APARRSGGLWQVDAQGRLLRVDPSTGDSFQTGLQSPQLKGMELVSALEDR
LQRVWLGNLTFGLSRMDLRTGDFVHWPSDGPEPSSALSAPEWIMEHGDTV
WMAFIDMVQQRDLRTGKVLQRMTQQDLHGLRAIDIQQLDQGPDGRVWVAG
EGGMFAWDDATGRFVPVAGLEGTPIQAFASQSADTLWVYRASGAEQWQKR
AAGWKRIRQVGEADGLNGFDASAMQIDPRGRVWISSLRGLWRIDPSVHPA
RVRNIGTRDGLTSQEFIQHCLLMSGGTLIGATSDGSTVLLDTAMPDVAPF
VPALQLEHVSVLRNGARIALPMDRPFQLGPEDRQLQIVSRLLSYSDPLSN
RYRSFLKGFDTDWQTIGNTGIREFASLPAGNYELALQGIDPLGNRSQVRS
LQFSVRPPWWRSEIGIALICFSGLLLSALLAAAYRRRIRMRAQWQLAQHK
RELAEQASLAKTRFLATLGHEVRTPMTGVLGMSELLLQTPLDGRQQGYAS
AIQLAGKHLLRLVNDALDLARIEAGKLPLDYRDFDLRQLVGQVVELVRPS
AEQKQLAFHCELDDALPPALHSDASRVQQILLNLLFNAVKFTERGSVHLR
VTTLPQHTRQGLRVEVRDTGPGMSAEQRGRLFQRFEQAEGALTLARHGGS
GLGLAICRELAAAMGGAVTVASELGQGACFVVELPLHWVSTLPAVTPPAV
CAPPMREQAPLQLLLVEDDATVAQVIVGLLQTRGHHVTHALHGLAALAEV
STRSFDAGLCDLDLPGLDGAALVAQLRARGVHFPIVAVTARADTDAEPQA
MAAGCNGFLRKPVTGELLAQALARVLADVDDGQRDNEAGDA
XFF4834R

XFF4834R_chr16110 lcl|XFF4834R_chr17340755_1864378_f2_XFF4834R-XFF4834R_chr16110

15

1176

S=1813 I=39 E=0

XFF4834R

XFF4834R_chr16120 lcl|XFF4834R_chr17370806_1868315_f3_XFF4834R-XFF4834R_chr16120

19

1176

S=1732 I=38 E=0

XFF4834R

XFF4834R_chr20180 lcl|XFF4834R_chr21680335_2316515_f3_XFF4834R-XFF4834R_chr20180

804

1175

S=460 I=34 E=1.24401e-48

XFF4834R

XFF4834R_chr04920 lcl|barA-XFF4834R_chr04920

801

1039

S=442 I=41 E=1.88734e-46

hybrid sensory histidine kinase, in two-component regulatory system with UvrY

XFF4834R

XFF4834R_chr32530 lcl|XFF4834R_chr35200757_3745873_f2_XFF4834R-XFF4834R_chr32530

793

1035

S=417 I=43 E=1.8991e-43

XFF4834R

XFF4834R_chr24780 lcl|XFF4834R_chr27100302_2863396_f2_XFF4834R-XFF4834R_chr24780

804

1178

S=399 I=33 E=3.49042e-41

XFF4834R

XFF4834R_chr21590 lcl|XFF4834R_chr23530104_2506487_r2_XFF4834R-XFF4834R_chr21590

801

1176

S=353 I=32 E=1.1884e-35

XFF4834R

XFF4834R_chr35800 lcl|XFF4834R_chr39000203_4152314_r2_XFF4834R-XFF4834R_chr35800

801

1172

S=352 I=34 E=1.43968e-35

XFF4834R

XFF4834R_chr35690 lcl|XFF4834R_chr38910286_4142022_f1_XFF4834R-XFF4834R_chr35690

810

1169

S=335 I=28 E=1.6815e-33

XFF4834R

XFF4834R_chr32620 lcl|XFF4834R_chr35330226_3757098_r1_XFF4834R-XFF4834R_chr32620

795

1036

S=320 I=35 E=1.07612e-31

X.species

NP_643340.1 lcl|XAC3031-XAC3031

15

1191

S=5721 I=94 E=0

histidine kinase-response regulator hybrid protein

X.species

YP_364899.1 lcl|XCV3168

15

1191

S=5644 I=93 E=0

two-component system sensor histidine kinase-response regulator hybrid protein

X.species

NP_638196.1 lcl|XCC2848

16

1178

S=3315 I=58 E=0

histidine kinase/response regulator hybrid protein

X.species

NP_643338.1 lcl|XAC3029-XAC3029

15

1176

S=1820 I=40 E=0

histidine kinase-response regulator hybrid protein

X.species

YP_364897.1 lcl|XCV3166

15

1176

S=1808 I=39 E=0

two-component system sensor histidine kinase-response regulator hybrid protein

X.species

lcl|XALc_2174

17

1172

S=1759 I=40 E=0

putative two component system sensor-response regulator hybrid protein

X.species

NP_643337.2 lcl|XAC3028-XAC3028

16

1176

S=1734 I=39 E=0

histidine kinase-response regulator hybrid protein

X.species

YP_364896.1 lcl|XCV3165

15

1176

S=1730 I=38 E=0

two-component system sensor histidine kinase-response regulator hybrid protein

X.species

NP_638194.1 lcl|XCC2846

17

1179

S=1726 I=39 E=0

histidine kinase/response regulator hybrid protein

X.species

YP_364898.1 lcl|XCV3167

23

1170

S=1578 I=38 E=0

two-component system sensor histidine kinase-response regulator hybrid protein

pubmed

798

1097

S=514 I=41 E=5.42792e-53

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 14660379

 

prodomImg

pubmed

798

1180

S=496 I=36 E=7.68012e-51

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 18484997

 

prodomImg

pubmed

804

1174

S=496 I=35 E=8.37979e-51

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 18487337

 

prodomImg

pubmed

801

1173

S=470 I=33 E=1.23748e-47

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 15186417

 

prodomImg

pubmed

801

1037

S=464 I=40 E=6.42965e-47

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 15262936

 

prodomImg

pubmed

804

1036

S=463 I=43 E=8.64826e-47

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 11123673

 

prodomImg

pubmed

804

1036

S=462 I=43 E=1.23645e-46

Sensory/regulatory protein rpfC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transcription regulation

Pubmed 1645442

 

prodomImg

pubmed

799

1036

S=460 I=44 E=1.78323e-46

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17574998

 

prodomImg

pubmed

793

1030

S=458 I=43 E=3.48955e-46

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 12107144

 

prodomImg

pubmed

793

1030

S=458 I=43 E=3.7744e-46

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 16598018

 

prodomImg

Iprscan IPR003594 [G3DSA:3.30.565.10]

877

1038

ATP-binding region, ATPase-like

Iprscan [G3DSA:3.40.50.2300]

1061

1176

-

Iprscan IPR011110 [PF07494]

35

58

Two component regulator propeller

Iprscan IPR011110 [PF07494]

80

103

Two component regulator propeller

Iprscan IPR011110 [PF07494]

125

147

Two component regulator propeller

Iprscan IPR011110 [PF07494]

170

193

Two component regulator propeller

Iprscan IPR011110 [PF07494]

255

277

Two component regulator propeller

Iprscan IPR011110 [PF07494]

476

502

Two component regulator propeller

Iprscan IPR011110 [PF07494]

564

588

Two component regulator propeller

Iprscan IPR011123 [PF07495]

693

756

Two component regulator three Y

Iprscan IPR003661 [PF00512]

810

875

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [PF02518]

922

1037

ATP-binding region, ATPase-like

Iprscan IPR001789 [PF00072]

1063

1173

Signal transduction response regulator, receiver region

Iprscan IPR003661 [SM00388]

810

875

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [SM00387]

922

1038

ATP-binding region, ATPase-like

Iprscan IPR001789 [SM00448]

1061

1172

Signal transduction response regulator, receiver region

Iprscan IPR005467 [PS50109]

817

1038

Signal transduction histidine kinase, core

Iprscan IPR001789 [PS50110]

1062

1176

Signal transduction response regulator, receiver region

Iprscan [seg]

3

14

-

Iprscan [seg]

774

792

-

Iprscan [seg]

1043

1054

-

Iprscan [seg]

1106

1124

-

Iprscan [tmhmm]

759

781

-

PDA1H6T6

503

638

S=351 I=51 E=8.58556e-35

PD480883

343

500

S=251 I=39 E=1.36109e-22

PD323841

238

337

S=250 I=52 E=1.49809e-22

PDA27500

196

242

S=248 I=98 E=3.08901e-22

PDA1M9K1

639

691

S=212 I=75 E=6.13059e-18

PD918567

106

238

S=169 I=30 E=9.69111e-13

PD216254

692

762

S=167 I=45 E=1.73808e-12

PDA40923

832

920

S=164 I=34 E=4.34163e-12

PDA9M665

801

951

S=159 I=28 E=1.82989e-11

PDA45372

830

932

S=150 I=33 E=2.27366e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xecfiSh8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

337 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

51 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

23 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhouNSJ/XFF4834R_chr16090.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhouNSJ/XFF4834R_chr16090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhouNSJ/XFF4834R_chr16090.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhouNSJ/XFF4834R_chr16090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.