Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr16010metB1XFF4834R_chr16010cystathionine gamma-synthase

metB1 XFF4834R_chr16010
XFF4834R_chr16000
XFF4834R_chr16000
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16020
XFF4834R_chr16020
ID metB1
AC XFF4834R_chr16010
LT XFF4834R_chr16010
OR XFF4834R_chr from 1848245 to 1849462 on strand +
DE cystathionine gamma-synthase
IP Cys/Met metabolism, pyridoxal phosphate-dependent enzyme; O-succinylhomoserine (thiol)-lyase; Pyridoxal phosphate-dependent transferase, major region, subdomain 1; Pyridoxal phosphate-dependent transferase, major region, subdomain 2
CL 1.5.1.9 Methionine GO:0009086
EC
GO InterPro
Biological Process: cellular amino acid metabolic process (GO:0006520)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: pyridoxal phosphate binding (GO:0030170)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 42527.7 Da
SQ 405 aa
 
........10........20........30........40........50
| | | | |
MSFRDPTDAPCTAATAAVRAGIDRDTAYGAVTPPIVLSSNFSFDGFGNKR
QYDYTRSGNPTRDLLGEALAELEGGAGGVITSTGMGAINLVLNAVLQPGD
TLVVPHDAYGGSWRLFNALAKKGHFALITADLTDPRSLADALAQSPKLVL
IETPSNPLLRITDLRFVIEAAKKVGALTVVDNTFLSPALQKPLDFGADLV
LHSTTKYINGHSDVVGGAVVARDAQLHQQLVWWANALGLTGSPFDAFLTL
RGLRTLDARLRVHQENADAIAALLDGHAAVNQVYFPGLASHPGHALAARQ
QKGFGAMMSFELEGGEAAVRAFVDGLRYFTLAESLGGVESLIAHPASMTH
AAMTAEARAAAGISDGLLRLSIGIESAEDLLADLRAGLARAEATLTNASR
KQVDA
XFF4834R

XFF4834R_chr34960 lcl|XFF4834R_chr_4058666_4059853_r3_XFF4834R-XFF4834R_chr34960

18

375

S=741 I=43 E=3.62632e-83

X.species

NP_643348.1 lcl|metB-XAC3039

1

405

S=1717 I=84 E=0

cystathionine gamma-synthase

X.species

YP_364907.1 lcl|metB-XCV3176

1

405

S=1702 I=83 E=0

cystathionine gamma-synthase

X.species

NP_638204.1 lcl|metB-XCC2856

1

405

S=1651 I=80 E=0

cystathionine gamma-synthase

X.species

lcl|metC-XALc_2185

18

405

S=1502 I=74 E=8.48916e-175

putative cystathionine beta-lyases/cystathionine gamma-synthases protein

X.species

lcl|XALc_2712

18

375

S=764 I=45 E=2.513e-85

probable cys/met metabolism plp-dependent enzyme protein

X.species

NP_643909.1 lcl|metB-XAC3602

18

375

S=746 I=44 E=3.52485e-83

cystathionine gamma-lyase-like protein

X.species

NP_635990.1 lcl|metB-XCC0598

18

375

S=742 I=43 E=1.0301e-82

cystathionine gamma-lyase-like protein

X.species

YP_365456.1 lcl|XCV3725

18

375

S=726 I=43 E=9.59098e-81

Cys/Met metabolism PLP-dependent enzyme

X.species

NP_638415.1 lcl|metB-XCC3068

18

213

S=241 I=31 E=5.70156e-22

homocysteine synthase

X.species

NP_638415.1 lcl|metB-XCC3068

242

375

S=237 I=43 E=1.77109e-21

homocysteine synthase

pubmed

18

375

S=1001 I=53 E=1.69851e-112

Cystathionine gamma-synthase EC=2.5.1.48 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate Transferase

Pubmed 6361020,8346018

 

prodomImg

pubmed

18

375

S=998 I=54 E=3.47185e-112

Cystathionine-gamma-synthase ; Pyridoxal phosphate

Pubmed 16885444

 

prodomImg

pubmed

18

375

S=761 I=45 E=1.92274e-83

Probable cystathionine gamma-synthase ; Pyridoxal phosphate

Pubmed 12375103

 

prodomImg

pubmed

18

375

S=743 I=43 E=3.10065e-81

Cystathionine gamma-synthase EC=4.2.99.9 ; Lyase Pyridoxal phosphate

Pubmed 11589581

 

prodomImg

pubmed

18

376

S=740 I=42 E=6.22836e-81

Cystathionine beta-lyase EC=4.4.1.8 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate

Pubmed 10618201,10620674

 

prodomImg

pubmed

18

376

S=734 I=42 E=3.4099e-80

Cystathionine beta-lyase EC=4.4.1.8 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate

Pubmed 10618201

 

prodomImg

pubmed

18

375

S=732 I=42 E=5.85471e-80

Cystathionine gamma-lyase EC=4.4.1.1 ; Amino-acid biosynthesis Cysteine Cytoplasm Pyridoxal phosphate

Pubmed 17259634

 

prodomImg

pubmed

18

376

S=727 I=42 E=2.62292e-79

Cystathionine beta-lyase EC=4.4.1.8 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate

Pubmed 17088354

 

prodomImg

pubmed

18

375

S=719 I=41 E=2.76147e-78

Cystathionine gamma-synthase EC=2.5.1.48 ; Pyridoxal phosphate Transferase

Pubmed 17981822

 

prodomImg

pubmed

18

375

S=702 I=40 E=2.4189e-76

Cystathionine gamma-lyase-like protein ; Pyridoxal phosphate

Pubmed 9150229,10094698

 

prodomImg

Iprscan [coil]

374

402

-

Iprscan IPR015421 [G3DSA:3.40.640.10]

9

256

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan IPR015422 [G3DSA:3.90.1150.10]

257

394

Pyridoxal phosphate-dependent transferase, major region, subdomain 2

Iprscan IPR000277 [PIRSF001434]

14

392

Cys/Met metabolism, pyridoxal phosphate-dependent enzyme

Iprscan IPR000277 [PF01053]

14

389

Cys/Met metabolism, pyridoxal phosphate-dependent enzyme

Iprscan IPR011821 [TIGR02080]

12

391

O-succinylhomoserine (thiol)-lyase

Iprscan IPR000277 [PS00868]

198

212

Cys/Met metabolism, pyridoxal phosphate-dependent enzyme

Iprscan [seg]

5

17

-

Iprscan [seg]

64

78

-

Iprscan [seg]

214

221

-

Iprscan [seg]

351

361

-

Iprscan [seg]

377

393

-

PD590311

287

347

S=157 I=57 E=1.42347e-11

PD596743

192

373

S=125 I=29 E=1.28898e-07

PD945095

18

47

S=122 I=73 E=2.50046e-07

PDA328A5

95

127

S=117 I=64 E=9.49194e-07

PD585777

242

283

S=117 I=55 E=1.15996e-06

PDA338C0

190

233

S=108 I=48 E=1.27566e-05

PDA1F7T5

189

213

S=107 I=72 E=1.68617e-05

PDA1B6M3

140

188

S=103 I=49 E=5.81548e-05

PD531643

187

212

S=101 I=65 E=8.09976e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one bUzYqxUa)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

115 hits
swiss-prot

Swiss-Prot ncbi-blastp

49 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtUb32v/XFF4834R_chr16010.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtUb32v/XFF4834R_chr16010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtUb32v/XFF4834R_chr16010.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtUb32v/XFF4834R_chr16010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.