Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr15630XFF4834R_chr16890385_1811549_r2_acur-XFF4834R_chr15630XFF4834R_chr15630hypothetical protein

XFF4834R_chr16890385_1811549_r2_acur-XFF4834R_chr15630 XFF4834R_chr15630
XFF4834R_chr15620
XFF4834R_chr15620
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15640
XFF4834R_chr15640
ID XFF4834R_chr16890385_1811549_r2_acur-XFF4834R_chr15630
AC XFF4834R_chr15630
LT XFF4834R_chr15630
OR XFF4834R_chr from 1811385 to 1811549 on strand -
DE hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN orf non retrouve avec framD (meme ACUR et diminution des parametres) ; mauvais usage du code MAIS 1 start et 1 stop OK et 2 hits blastx ncbi pour hypothetical protein chez X camp donc ne pas deleter
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by bonneau (20100819)
MW 6104 Da
SQ 54 aa
 
........10........20........30........40........50
| | | | |
MLRRSVCLCPEMLHCSAVAATSEICDDVLTTLSGLRETRFKSGVWQEGPW
TVRY
Iprscan [SignalP-NN(euk)]

1

21

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ROY4tRUD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBELzFPG/XFF4834R_chr15630.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBELzFPG/XFF4834R_chr15630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBELzFPG/XFF4834R_chr15630.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBELzFPG/XFF4834R_chr15630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.