Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr15460XFF4834R_chr15460beta-galactosidase

XFF4834R_chr15460
XFF4834R_chr15450
XFF4834R_chr15450
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15470
XFF4834R_chr15470
ID
AC XFF4834R_chr15460
LT XFF4834R_chr15460
OR XFF4834R_chr from 1780676 to 1782517 on strand -
DE beta-galactosidase
IP
CL 1.2.4 Polysaccharides GO:0000272
EC
GO InterPro


Curated
PM
AN probably involved in N-glycans degradation
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110112)
MW 67718 Da
SQ 613 aa
 
........10........20........30........40........50
| | | | |
MLRTTLAPLALSLAFALPITGAAADTERWPNFGTQGTQFVRDGKPYQLLS
GAIHFQRIPRAYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFSGNN
DVAAFVREAAAQGLNVILRPGPYACAEWEAGGYPAWLFGKGNIRVRSRDP
RFLAASQAYLDALAKQVQPLLNHNGGPIIAVQVENEYGSYADDHAYMADN
RAMYVKAGFDKALLFTSDGADMLANGTLPDTLAVVNFAPGEAKSAFDKLI
KFRPDQPRMVGEYWAGWFDHWGKPHAATDARQQAEEFEWILRQGHSANLY
MFIGGTSFGFMNGANFQNNPSDHYAPQTTSYDYDAILDEAGHPTPKFALM
RDAIARVTGVQPPALPAPIATTTLPATPLRESASLWDNLPAPIAIDTPQP
MEQFGQDYGYILYRTTITGPRKGPLYLGDVRDVARVYVDQRPVGSVERRL
QQVSLEVEIPGGQHTLDVLVENSGRINYGTRMADGRAGLVDPVLLDSQQL
TGWQAFPLPMRTPDSIRGWTGKAVQGPAFHRGTLRIGTPTDTYLDMRAFG
KGFAWANGVNLGRHWNIGPQTALYFPAPFQRKGDNTVVVFDLDDVATPSV
RGLKQQVWLKPKD
XFF4834R

XFF4834R_chr25620 lcl|XFF4834R_chr28120927_2968567_r3_XFF4834R-XFF4834R_chr25620

24

189

S=122 I=33 E=5.01806e-08

X.species

NP_643393.1 lcl|bga-XAC3084

1

613

S=3009 I=93 E=0

beta-galactosidase

X.species

YP_364945.1 lcl|bga1-XCV3214

29

613

S=2954 I=95 E=0

beta-galactosidase

X.species

NP_638243.1 lcl|bga-XCC2895

1

613

S=2793 I=85 E=0

beta-galactosidase

X.species

lcl|XALc_2224

26

611

S=2303 I=75 E=0

putative beta-galactosidase protein

X.species

NP_643387.1 lcl|bga-XAC3078

32

600

S=836 I=35 E=6.46434e-94

beta-galactosidase

X.species

NP_637758.1 lcl|XCC2404

22

189

S=126 I=32 E=7.3523e-08

hypothetical protein

X.species

NP_642855.1 lcl|XAC2540-XAC2540

24

189

S=118 I=32 E=6.79176e-07

hypothetical protein

X.species

YP_364467.1 lcl|XCV2736

24

189

S=116 I=32 E=1.19703e-06

putative secreted protein

pubmed

1

613

S=2783 I=85 E=0

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 15153767

 

prodomImg

pubmed

27

575

S=2782 I=96 E=0

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase Signal

Pubmed 8563148

 

prodomImg

pubmed

34

592

S=1157 I=43 E=3.57291e-131

Beta-galactosidase

Pubmed 9301106

 

prodomImg

pubmed

31

601

S=974 I=38 E=5.23869e-109

BgaC

Pubmed 11679331

 

prodomImg

pubmed

38

593

S=961 I=40 E=2.13053e-107

Beta-galactosidase EC=3.2.1.23 ; Glycoprotein Glycosidase Hydrolase Lysosome Polymorphism Signal

Pubmed 8725782

 

prodomImg

sp

27

575

S=2782 I=96 E=0

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase Signal

 

prodomImg

sp

34

591

S=1047 I=40 E=4.91468e-118

Beta-galactosidase-1-like protein 2 EC=3.2.1.- ; Alternative splicing Glycosidase Hydrolase Secreted Signal

 

prodomImg

sp

35

601

S=1035 I=41 E=1.7385e-116

Beta-galactosidase-1-like protein 2 EC=3.2.1.- ; Glycosidase Hydrolase Secreted Signal

 

prodomImg

sp

38

599

S=964 I=41 E=5.90434e-108

Beta-galactosidase EC=3.2.1.23 ; Glycoprotein Glycosidase Hydrolase Lysosome Signal Zymogen

 

prodomImg

sp

38

607

S=962 I=39 E=9.87586e-108

Beta-galactosidase-1-like protein EC=3.2.1.- ; Alternative splicing Glycoprotein Glycosidase Hydrolase Secreted Signal

 

prodomImg

PD858963

403

460

S=275 I=90 E=9.94299e-26

PD685864

119

232

S=215 I=45 E=2.0561e-18

PD003386

39

117

S=199 I=50 E=1.4997e-16

PD328308

255

357

S=195 I=44 E=4.82389e-16

PDA1T348

220

254

S=178 I=100 E=6.14743e-14

PD403289

524

592

S=160 I=48 E=7.97193e-12

PD870504

443

520

S=154 I=40 E=4.93109e-11

PD830736

381

469

S=140 I=39 E=2.49385e-09

PDA553S4

332

448

S=130 I=35 E=4.16784e-08

PDA1Q523

380

403

S=120 I=96 E=5.80011e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one n8ZBYL4C)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

60 hits
swiss-prot

Swiss-Prot ncbi-blastp

57 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvV8nqL/XFF4834R_chr15460.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvV8nqL/XFF4834R_chr15460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvV8nqL/XFF4834R_chr15460.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvV8nqL/XFF4834R_chr15460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.