Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr15400xopLXFF4834R_chr15400Xanthomonas outer protein L, Type III effector XopL

xopL XFF4834R_chr15400
XFF4834R_chr15390
XFF4834R_chr15390
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15410
XFF4834R_chr15410
ID xopL
AC XFF4834R_chr15400
LT XFF4834R_chr15400
OR XFF4834R_chr from 1773175 to 1774890 on strand -
DE Xanthomonas outer protein L, Type III effector XopL
IP Toll-like receptor 7, leucine rich repeat-containing
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro
Molecular Function: protein binding (GO:0005515)

Curated
PM
AN trouvee par blastp avec xopL de xav
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20110713)
MW 63348.2 Da
SQ 571 aa
 
........10........20........30........40........50
| | | | |
MNEAAGHSLRSPQLPQLSDIERARFHTVTTDSQRLRPVRPRMPPTVGASP
LRRSPAIRPYRDVLSQWQRHYNADRDRWHSAWRHANRNNPQVETRTDRAL
KATADLLEDASQTGRVTLELRSVPLPQFPDQAFRLSHLQHMTIDAAGLME
LPDAMQQFAGLETLTLAHNPLRSLPASIASLTQLRELSIRVCPELTELPE
HLASTNASGEHEGLVNLQSLRLERTGIRSLPASIANLQNLKSLKIRNSPL
SALGPAIHQLPKLEELDLRGCTALRDYPPIFGGSAPLKRLILKDCSNLLT
LPLDIHRLTQLEKLDLRGCVNLSRLPSLIARLPANCIIRVPPHLQAQLDQ
HRPVARPAQPERAGPTAPVPSPPVPGNRARATSSAATTEPPRTVALERIE
DTAQTMLSTVIDEERNPFLEGAPSYLPEKRLPGAPTTFGQIPALQKMLEE
SRDSHFLRRVSDMAGPSPRVEDPSEEGLARHYTNVSNWKAQKSAHLGIVD
HLGQFVYHAGSQLDAATLAKAVQMWKTRELIVNAHPQDRARFPAFTLHIP
EQVGDDAEDERQASPEASGQQ
XFF4834R

XFF4834R_chr03780 lcl|XFF4834R_chr03890655_0430667_r2_XFF4834R-XFF4834R_chr03780

100

352

S=226 I=35 E=1.48781e-20

X.species

YP_364951.1 lcl|XCV3220

1

571

S=2380 I=83 E=0

hypothetical protein

X.species

NP_643399.2 lcl|XAC3090-XAC3090

46

355

S=1474 I=92 E=3.38927e-171

leucin rich protein

X.species

NP_643399.2 lcl|XAC3090-XAC3090

394

571

S=810 I=85 E=8.56552e-91

leucin rich protein

X.species

NP_639520.1 lcl|XCC4186

45

558

S=941 I=42 E=1.20905e-106

leucin rich protein

X.species

NP_640748.2 lcl|hpaF-XAC0393

86

362

S=250 I=36 E=5.66037e-23

HpaF protein

X.species

YP_362139.1 lcl|hpaG-XCV0408

170

352

S=164 I=37 E=1.45193e-12

HpaG LRR protein

X.species

YP_362139.1 lcl|hpaG-XCV0408

148

308

S=141 I=35 E=1.12474e-09

HpaG LRR protein

X.species

NP_637913.1 lcl|XCC2565

109

258

S=130 I=32 E=1.96347e-08

leucin rich protein

pubmed

86

362

S=248 I=36 E=4.13101e-21

HpaF

Pubmed 12730176

 

prodomImg

pubmed

100

352

S=229 I=34 E=8.88268e-19

Leucine rich hrp associated protein

Pubmed 15986924

 

prodomImg

pubmed

116

332

S=228 I=35 E=1.19477e-18

Disease resistance protein RPP1-like protein R2 ; ATP-binding Leucine-rich repeat Nucleotide-binding

Pubmed 19106299

 

prodomImg

pubmed

118

328

S=182 I=33 E=4.28635e-13

Disease resistance protein RPP1-like protein R2 ; ATP-binding Leucine-rich repeat Nucleotide-binding

Pubmed 19106299

 

prodomImg

pubmed

217

326

S=129 I=34 E=1.33642e-06

Disease resistance protein RPP1-like protein R2 ; ATP-binding Leucine-rich repeat Nucleotide-binding

Pubmed 19106299

 

prodomImg

sp

136

333

S=199 I=34 E=2.56366e-15

Protein popC ; Leucine-rich repeat Plasmid Secreted

 

prodomImg

sp

132

326

S=179 I=33 E=7.88123e-13

Protein popC ; Leucine-rich repeat Plasmid Secreted

 

prodomImg

sp

64

282

S=164 I=32 E=4.82864e-11

Protein popC ; Leucine-rich repeat Plasmid Secreted

 

prodomImg

sp

117

352

S=158 I=30 E=2.85938e-10

Protein popC ; Leucine-rich repeat Plasmid Secreted

 

prodomImg

sp

117

328

S=155 I=31 E=5.84474e-10

Protein popC ; Leucine-rich repeat Plasmid Secreted

 

prodomImg

Iprscan [G3DSA:3.80.10.10]

114

333

-

Iprscan [PTHR23155]

93

317

-

Iprscan IPR001611 [PF00560]

310

328

Leucine-rich repeat

Iprscan IPR003591 [SM00369]

158

181

Leucine-rich repeat, typical subtype

Iprscan IPR003591 [SM00369]

214

236

Leucine-rich repeat, typical subtype

Iprscan IPR003591 [SM00369]

237

260

Leucine-rich repeat, typical subtype

Iprscan IPR003591 [SM00369]

308

332

Leucine-rich repeat, typical subtype

Iprscan [seg]

363

376

-

Iprscan [seg]

378

393

-

PD604688

394

571

S=552 I=59 E=2.65819e-59

PD695373

45

127

S=202 I=49 E=5.57638e-17

PDA2Q254

1

46

S=183 I=78 E=1.4028e-14

PDA726N0

248

286

S=177 I=82 E=6.5646e-14

PDA7V2A9

127

170

S=177 I=77 E=7.16264e-14

PDA2E4S5

321

355

S=169 I=97 E=6.85138e-13

PDA9A0T0

294

352

S=143 I=53 E=7.99553e-10

PDA726H4

271

294

S=116 I=92 E=1.90726e-06

PDA19589

190

213

S=112 I=88 E=4.60094e-06

PDA4I5M7

154

200

S=103 I=52 E=6.5725e-05

Iprscan [SSF52058]

67

333

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CUy7zUX2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

380 hits
swiss-prot

Swiss-Prot ncbi-blastp

222 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQw7l8n/XFF4834R_chr15400.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQw7l8n/XFF4834R_chr15400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQw7l8n/XFF4834R_chr15400.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQw7l8n/XFF4834R_chr15400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.