Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr15340pilLXFF4834R_chr15340probable two-component system sensor histidine kinase-response regulator hybrid protein PilL

pilL XFF4834R_chr15340
XFF4834R_chr15330
XFF4834R_chr15330
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15350
XFF4834R_chr15350
ID pilL
AC XFF4834R_chr15340
LT XFF4834R_chr15340
OR XFF4834R_chr from 1761122 to 1768309 on strand +
DE probable two-component system sensor histidine kinase-response regulator hybrid protein PilL
IP Signal transduction response regulator, receiver region; CheW-like protein; ATP-binding region, ATPase-like; Signal transduction histidine kinase, subgroup, homodimeric; Signal transduction histidine kinase, phosphotransfer (Hpt) region
CL 1.6.13 Fimbria, pili, curli GO:0009297
EC
GO InterPro
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
Biological Process: chemotaxis (GO:0006935)
Biological Process: signal transduction (GO:0007165)
Cellular Component: cytoplasm (GO:0005737)
Cellular Component: intracellular (GO:0005622)
DNA-dependent (GO:0006355)
Molecular Function: two-component response regulator activity (GO:0000156)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: protein histidine kinase activity (GO:0004673)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: signal transducer activity (GO:0004871)

Curated
PM
AN
CC COG: [NST] Cell motility;Function unknown;Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110317)
MW 255654.4 Da
SQ 2395 aa
 
........10........20........30........40........50
| | | | |
MSALRDAMSHAALGWVKPELDETLRQARNEIEYFAEEPSDTSRMRFCAGY
LHQVQGTLRMVELYAPAMVAEELELLAQAVQAGEVADRDEACAMLMRGTV
LLPDYLERLQNGHRDIPIVLLPLLNEIRATRGQPGLSESVLFAFDPQAGV
ATEAELDHARGSLSGRNRELLDTVGNAVKEELLRVKDALDLHLRTGGEIA
ELQTQVNDLGSVADTLGMMGLGVARSVVVQQRDALARVVDGQTQMDESVL
LDIAGALLYVDASLDDQVASLGADPGDGTEVSNSANSSEVRRTVDVLAQE
AIANFGAAREHFVAFIETNWDHARLAEVPHLLGEVGGALRILELPQAADY
LEGVRRYVDLELIGKQRVPSGRQLDTLADAMASLEYYLEALRERRPGREE
ILDITRNSLETLRYWPLPSGQPSDLPVGADQPGSAAEPQPAAAPPLQHAD
APQAANDAASLPSLEWANETVVETPFAASVVHDTGAAATDTVFSFDPVAA
EETVSGQSHVPFTVAPLDLSDDGAQAPGDWHLETTEQAAPIATSAFDPVS
AEQDGNETAQVSYTVDLSALEQEHAAEPVVAEDAPLQIQQIDLPGDDDQT
DAPLDFIAENATRRAQTGIEDAFSPPPSPPQELDDPFVEPAQEPQDVPSE
AASEPVAPRVQQAVVSEFELDDASAAFLAQLDAAAAQFDVERPQAPTVAA
DAQPAQASSEPVSSERAQEAADAGIFGGFGDSDIDDDIRDVFLEEFDEEL
VNLGQLLPVWRAAPTNPETLRPIRRVFHTLKGSGRLVGASVLGEFSWKIE
SMLNRVLDNSRPASPAVVSMVELAYAVLPQFNAALRDQGRISADLPEIQG
IAERVAAGEEVYYVPAAAAPVADAVAIPVATAGVFAASGGTPASVDSVLR
EILEAEVATHLDTVNGWLQASQAEPQLATEELLRAVHTMSGAFAMTDVPE
ITLVTTPAESYVKRLLAASVTPSADGLEALTATAAAIAATVTALRADAPL
IPSFAPLTERLRALVDTLPEAQWPPQAFLDELDDVDAPGATADGSDASVE
LTGAQDLSQYLDAGALPSDAPASTQDAEDGQPQPDDAPIAVDELAEAEAE
HDSALALDAPAPHAVDNAGHAAVHEDVHASAESVPASSDDALVPAAATGQ
LAESLHGDTAPDEEADRAPSQGIDAHDLPADEPLVEAEAWDATELQHAQT
APHAHAPGEHVAEHGEASAEVVSSEHDADATSTHADGIAVDELADAEAAL
GDAQTLAAADAEQAVDAQAQHVPAHDDQVAAGADEAVESIEALEAVHADA
ALADEANATTAEDWTPETAALDSAPSDQPGHEHADTQEYAGEQPADELAQ
HGDAARLHDGEPYAGQDRPLEEAAQLGEHAEAEAQTSSNQQMDSGDGASA
DAQQHVHEQVPSDQYVEAGEQLQTHAHFDEHAGDAEHATDHERIETAHSE
AEHAEAEHVAAEQAEAEHSEAEDADADRVDAAQADADVLPDHTVESVQAF
EMAHAADQVEEAGDPQSDTAPELHDTQTATSDDAAQADAQAALDAFDVVD
HADHAERAEQFESAGHAAHAEQAEASDQAGADQHADEPEDTAAAAFSAPV
EDAARAGAASNDIGAAFDAGPLNFDQLDGELVDIFVEEGRDLLDHCDGLI
ARMREVPGDRDVLNGLQRDLHTLKGGARMAGINAIGDLGHAIESLLEAVA
ANRTDIDRDDVRLFERGFDRLHQLLTRTGMHRAVTMPTDLVEAFETRTRG
RNAAAPSDADVRAIAKASVEPAPLSAPVPVEGQAEEDFLPRAQQEQVRVR
ADLLDRLVNHAGEVAIYRSRLEQQLGAFRGAMGELDRTNARLRDQLRRLD
LETEAQIVARYQREQDQGDRTFDPLELDRFSTLQQLSRALNESAADLGGL
QGVLEDLSRQYDGLLQQQSRVSSELQDGLMRARMVPFDGLVPRLRRVVRQ
AASDTGKQVHLVLEGTQGELDRNVLDRMVAPLEHMLRNSVAHGLETPEQR
RDAGKPEEGSIAIRLRREGSEIVLEVADDGAGLDREAIRRRGEERGLIEP
GQELSEAELDHLIFASGFSTSEQVSQLAGRGVGMDVVRNEVRQLGGSVDI
HSVRGQGATFTLRLPQTLAVTQAVFVRIGETTFAVPVGSVSGIGRISRTR
YESGEGGYHYAGEEYVLHDLGSLVGQPAARADGQAQVPLLLVRAGDLRAA
VAIDQVLGNREVVVKPVGLQIASVPGIYGATITGDGRVVVILDVAPLVRR
FLAQPARPSLETQAEAQRQVPLVMVVDDSLTMRKVTSRVLERHNLDVSTA
RDGVEALELLEERVPDLMLLDIEMPRMDGYELATAMRADPRFKAVPIVMI
TSRSGEKHRQRAFEIGVQRYLGKPYQELDLMRNVYDLLGIARVRD
XFF4834R

XFF4834R_chr20600 lcl|XFF4834R_chr22370183_2384841_r1_XFF4834R-XFF4834R_chr20600

1922

2244

S=507 I=37 E=5.5745e-54

XFF4834R

XFF4834R_chr20600 lcl|XFF4834R_chr22370183_2384841_r1_XFF4834R-XFF4834R_chr20600

1635

1896

S=132 I=25 E=1.28391e-08

XFF4834R

XFF4834R_chr20490 lcl|XFF4834R_chr22240726_2371735_r3_XFF4834R-XFF4834R_chr20490

1914

2251

S=484 I=35 E=3.10043e-51

XFF4834R

XFF4834R_chr20490 lcl|XFF4834R_chr22240726_2371735_r3_XFF4834R-XFF4834R_chr20490

1635

1725

S=113 I=31 E=3.174e-06

XFF4834R

XFF4834R_chr17680 lcl|XFF4834R_chr18840111_2022120_r1_XFF4834R-XFF4834R_chr17680

1924

2251

S=484 I=33 E=3.10043e-51

XFF4834R

XFF4834R_chr15300 lcl|XFF4834R_chr16420620_1758021_f1_XFF4834R-XFF4834R_chr15300

2273

2384

S=220 I=36 E=3.29368e-19

XFF4834R

XFF4834R_chr24790 lcl|XFF4834R_chr27140430_2864416_f2_XFF4834R-XFF4834R_chr24790

2271

2375

S=195 I=39 E=3.14529e-16

XFF4834R

XFF4834R_chr33920 lcl|XFF4834R_chr36750544_3913930_r3_XFF4834R-XFF4834R_chr33920

2273

2386

S=174 I=27 E=1.07358e-13

XFF4834R

XFF4834R_chr24780 lcl|XFF4834R_chr27100302_2863396_f2_XFF4834R-XFF4834R_chr24780

2256

2388

S=164 I=29 E=2.00955e-12

X.species

NP_643407.1 lcl|pilL-XAC3098

1

2395

S=9693 I=83 E=0

PilL protein

X.species

YP_364960.1 lcl|pilL-XCV3229

1

2395

S=9524 I=82 E=0

two-component system sensor histidine kinase-response regulator hybrid protein PilL

X.species

NP_638269.1 lcl|pilL-XCC2921

1591

2395

S=3714 I=90 E=0

PilL protein

X.species

NP_638269.1 lcl|pilL-XCC2921

743

1195

S=1211 I=61 E=1.09972e-138

PilL protein

X.species

NP_638269.1 lcl|pilL-XCC2921

1489

1521

S=113 I=67 E=1.10222e-05

PilL protein

X.species

lcl|pilL-XALc_2238

1615

2395

S=3033 I=77 E=0

probable two-component system sensor histidine kinase-response regulator hybrid protein pill

X.species

lcl|pilL-XALc_2238

1

419

S=1663 I=78 E=0

probable two-component system sensor histidine kinase-response regulator hybrid protein pill

X.species

lcl|pilL-XALc_2238

743

1090

S=819 I=56 E=2.9583e-91

probable two-component system sensor histidine kinase-response regulator hybrid protein pill

X.species

NP_642256.2 lcl|cheA-XAC1930

1922

2244

S=508 I=37 E=1.47736e-53

chemotaxis related protein

X.species

NP_642256.2 lcl|cheA-XAC1930

1635

1896

S=125 I=25 E=4.45488e-07

chemotaxis related protein

pubmed

1

973

S=4043 I=83 E=0

Hypothetical twitching motility protein PilL

Pubmed 11204784

 

prodomImg

pubmed

1860

2392

S=647 I=34 E=7.93474e-69

WspE

Pubmed 12019221

 

prodomImg

pubmed

1889

2254

S=615 I=35 E=5.98293e-65

CheA Chemotaxis protein CheA ; Kinase Transferase

Pubmed 10333522

 

prodomImg

pubmed

1852

2388

S=607 I=33 E=6.81316e-64

Gliding motility regulatory protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component system

Pubmed 2165608,2123853

 

prodomImg

pubmed

1916

2248

S=604 I=39 E=1.27637e-63

Chemotaxis protein cheA EC=2.7.13.3 ; ATP-binding Cytoplasm Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 9255518

 

prodomImg

pubmed

1890

2373

S=593 I=36 E=3.537e-62

CheA4

Pubmed 15186426

 

prodomImg

pubmed

1868

2248

S=585 I=33 E=2.69706e-61

Chemotaxis protein cheA EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 1938941

 

prodomImg

pubmed

1875

2264

S=579 I=36 E=1.75788e-60

Chemotaxis protein cheA EC=2.7.13.3 ; ATP-binding Cytoplasm Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 7623670

 

prodomImg

pubmed

1921

2254

S=572 I=35 E=9.96561e-60

CheA ; Kinase Transferase

Pubmed 12423023

 

prodomImg

pubmed

1886

2247

S=568 I=34 E=3.23357e-59

Chemotaxis protein cheA EC=2.7.13.3 ; ATP-binding Cytoplasm Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 9765799

 

prodomImg

sp

1852

2388

S=607 I=33 E=4.71812e-64

Gliding motility regulatory protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component system

 

prodomImg

sp

1916

2248

S=604 I=39 E=8.83888e-64

Chemotaxis protein cheA EC=2.7.13.3 ; ATP-binding Cytoplasm Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

 

prodomImg

sp

1868

2248

S=585 I=33 E=1.86772e-61

Chemotaxis protein cheA EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

 

prodomImg

sp

1875

2264

S=579 I=36 E=1.21733e-60

Chemotaxis protein cheA EC=2.7.13.3 ; ATP-binding Cytoplasm Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

 

prodomImg

sp

1886

2247

S=568 I=34 E=2.23925e-59

Chemotaxis protein cheA EC=2.7.13.3 ; ATP-binding Cytoplasm Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

 

prodomImg

PD718632

999

1402

S=1051 I=62 E=1.82693e-119

PD156442

6

412

S=829 I=48 E=1.62285e-92

PD691639

528

669

S=525 I=76 E=1.06284e-55

PD483110

884

973

S=428 I=94 E=6.18212e-44

PDA1V5D6

1734

1796

S=299 I=95 E=2.57318e-28

PD691638

390

483

S=299 I=66 E=2.78323e-28

PD210682

1852

1933

S=223 I=59 E=4.6205e-19

PD691637

484

527

S=213 I=95 E=6.10231e-18

PD656200

1934

2026

S=187 I=43 E=9.41307e-15

PD303063

1582

1634

S=185 I=78 E=1.703e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RwLXNMBT)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

476 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

45 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBibBSl9/XFF4834R_chr15340.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBibBSl9/XFF4834R_chr15340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBibBSl9/XFF4834R_chr15340.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBibBSl9/XFF4834R_chr15340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.