Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr15250XFF4834R_chr16360600_1753624_f2_XFF4834R-XFF4834R_chr15250XFF4834R_chr15250putative ATP-dependent DNA helicase

XFF4834R_chr16360600_1753624_f2_XFF4834R-XFF4834R_chr15250 XFF4834R_chr15250
XFF4834R_chr_1640
XFF4834R_chr_1640
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15260
XFF4834R_chr15260
ID XFF4834R_chr16360600_1753624_f2_XFF4834R-XFF4834R_chr15250
AC XFF4834R_chr15250
LT XFF4834R_chr15250
OR XFF4834R_chr from 1751600 to 1753624 on strand +
DE putative ATP-dependent DNA helicase
IP Helicase, ATP-dependent, c2 type; Helicase, superfamily 1/2, ATP-binding domain, DinG/Rad3-type
CL 2 Information transfer
EC
GO InterPro
Molecular Function: nucleic acid binding (GO:0003676)
Molecular Function: ATP-dependent helicase activity (GO:0008026)
Molecular Function: ATP binding (GO:0005524)
in phosphorus-containing anhydrides (GO:0016818)
nucleotide and nucleic acid metabolic process (GO:0006139)

Curated
PM
AN This domain of unknown function is found at the C terminus of some ATP-dependent helicases characterised by a 'D-E-A-H' motif. This resembles the 'D-E-A-D-box' of other known helicases, a special version of the B motif of ATP-binding proteins however His replaces the second Asp. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre-mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression.
CC COG: [KL] Transcription;Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 72843.1 Da
SQ 674 aa
 
........10........20........30........40........50
| | | | |
MSQLATASIEALSEGGALARQLDAFAPRAAQLRLTGAIAEAFEQRDVLLA
EAGTGTGKTYAYLVPALLSGLKTIVSTGTRALQDQLFHRDLPRVRAALGV
GLRSALLKGRANYLCKYRTQQARGEPRFATPEQVSQFQRIVAWSGRTQFG
DMAELEALPDDSPLLPMVTSTVDNCLGTDCPFYSECFVVQARQRAQAADL
VVVNHHLLLADLALKQEGFGEILPGAQAFVIDEAHQLPELAANFFGESFG
MRPWQELARDCMVEARLVAGAQASLQAPILALDEALRSLRAGMEGLPPRG
TQWRALAKPQVREGFDAVLSSLARLGESLLPLREASPGFDGCTARAQEAL
NRLSRWLGEDLPVADFAQDPPEETVDNDVLWYELSPRGFRCQRTPLDVSG
PLRDHREKSHAAWVFTSATLAVGGEFDHIAQRLGLSDPVTLLQPSPFDWA
RQALCYLPPNLPDPAARGFGTALIGALTPVLEASNGRAFLLFASHRALRE
AAEALRGAPWPLFVQGEAPRATLLRRFRDSGNGVLLGSASFREGVDVVGD
ALSVVVIDKLPFAAPDDPVFEARLDAIRREGGNPFRDEQLPQAVIALKQG
VGRLIRSETDRGVLVLCDPRLVNKSYGRTFMKSLPPFARTHAIADVQAFF
GVEPAVGDNGALALPVGGDRSSSS
XFF4834R

XFF4834R_chr38970 lcl|dinG-XFF4834R_chr38970

25

640

S=362 I=28 E=5.77301e-37

ATP-dependent DNA helicase

X.species

NP_643416.1 lcl|yoaA-XAC3107

1

674

S=3160 I=93 E=0

ATP-dependent helicase

X.species

YP_364970.1 lcl|yoaA-XCV3239

1

658

S=3034 I=92 E=0

ATP-dependent helicase

X.species

NP_638278.1 lcl|yoaA-XCC2930

1

661

S=2908 I=87 E=0

ATP-dependent helicase

X.species

lcl|DinG-XALc_2247

4

651

S=2522 I=78 E=0

putative dna helicase protein

X.species

YP_365854.1 lcl|dinG-XCV4123

25

640

S=375 I=28 E=4.86718e-38

ATP-dependent DNA helicase DinG

X.species

NP_644330.1 lcl|dinG-XAC4031

381

640

S=248 I=31 E=1.35654e-22

ATP-dependent DNA helicase DinG

X.species

NP_644330.1 lcl|dinG-XAC4031

25

243

S=181 I=31 E=1.60421e-14

ATP-dependent DNA helicase DinG

X.species

NP_639289.1 lcl|dinG-XCC3950

381

640

S=244 I=31 E=3.63334e-22

ATP-dependent DNA helicase DinG

X.species

NP_639289.1 lcl|dinG-XCC3950

25

243

S=198 I=32 E=1.47272e-16

ATP-dependent DNA helicase DinG

X.species

lcl|dinG-XALc_2992

391

640

S=232 I=30 E=9.9811e-21

probable atp-dependent helicase protein

pubmed

381

640

S=325 I=33 E=2.28503e-30

Probable ATP-dependent helicase dinG homolog EC=3.6.1.- ; ATP-binding DNA damage recombination repair DNA-binding Hydrolase Nucleotide-binding

Pubmed 8396546

 

prodomImg

pubmed

18

244

S=213 I=31 E=8.21448e-17

Probable ATP-dependent helicase dinG homolog EC=3.6.1.- ; ATP-binding DNA damage recombination repair DNA-binding Hydrolase Nucleotide-binding

Pubmed 8396546

 

prodomImg

pubmed

414

639

S=321 I=36 E=8.45022e-30

Putative ATP-dependent helicase

Pubmed 10722573

 

prodomImg

pubmed

18

296

S=205 I=31 E=7.99573e-16

Putative ATP-dependent helicase

Pubmed 10722573

 

prodomImg

pubmed

376

635

S=302 I=29 E=1.55309e-27

Probable ATP-dependent helicase dinG homolog EC=3.6.1.- ; ATP-binding DNA damage recombination repair DNA-binding Hydrolase Nucleotide-binding

Pubmed 8760912

 

prodomImg

pubmed

9

247

S=234 I=31 E=2.76689e-19

Probable ATP-dependent helicase dinG homolog EC=3.6.1.- ; ATP-binding DNA damage recombination repair DNA-binding Hydrolase Nucleotide-binding

Pubmed 8760912

 

prodomImg

pubmed

25

614

S=271 I=23 E=8.70638e-24

Probable ATP-dependent helicase ypvA EC=3.6.1.- ; ATP-binding DNA-binding Hydrolase Nucleotide-binding

Pubmed 8760912

 

prodomImg

pubmed

11

237

S=263 I=30 E=8.6236e-23

ATP-dependent helicase DinG

Pubmed 16820506

 

prodomImg

pubmed

414

644

S=219 I=30 E=1.91529e-17

ATP-dependent helicase DinG

Pubmed 16820506

 

prodomImg

pubmed

381

640

S=245 I=31 E=1.22018e-20

ATP-dependent helicase Putative damage-inducible protein G

Pubmed 11133452

 

prodomImg

Iprscan IPR006555 [SM00491]

495

623

Helicase, ATP-dependent, c2 type

Iprscan IPR014013 [PS51193]

17

300

Helicase, superfamily 1/2, ATP-binding domain, DinG/Rad3-type

Iprscan [seg]

188

203

-

Iprscan [seg]

496

506

-

Iprscan [seg]

545

558

-

PD606638

240

380

S=564 I=77 E=1.07403e-60

PD329182

75

174

S=226 I=43 E=9.26665e-20

PD403018

379

474

S=181 I=42 E=2.76827e-14

PDA1F7H0

583

635

S=165 I=64 E=2.09081e-12

PD237538

180

260

S=143 I=34 E=1.1036e-09

PDA1T1X8

464

491

S=127 I=96 E=1.001e-07

PD493423

530

643

S=124 I=24 E=2.39379e-07

PDA2O2C6

156

187

S=123 I=56 E=2.56672e-07

PD428534

617

650

S=121 I=62 E=4.9359e-07

PDA4O5D4

650

674

S=121 I=100 E=5.43272e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 13Z7e4Qq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

51 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHgKw9G/XFF4834R_chr15250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHgKw9G/XFF4834R_chr15250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHgKw9G/XFF4834R_chr15250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHgKw9G/XFF4834R_chr15250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.