Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr14150XFF4834R_chr14150putative PQQ-dependent dehydrogenase

XFF4834R_chr14150
XFF4834R_chr14140
XFF4834R_chr14140
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14160
XFF4834R_chr14160
ID
AC XFF4834R_chr14150
LT XFF4834R_chr14150
OR XFF4834R_chr from 1618077 to 1620554 on strand -
DE putative PQQ-dependent dehydrogenase
IP Quinonprotein alcohol dehydrogenase-like; PQQ-dependent membrane bound dehydrogenase, glucose/quinate/shikimate related; PQQ-dependent dehydrogenase, methanol/ethanol family
CL 1.1.5 Others
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: quinone binding (GO:0048038)
acting on CH-OH group of donors (GO:0016614)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 88288 Da
SQ 825 aa
 
........10........20........30........40........50
| | | | |
MTDQSSKRGLGTWLLVAYAVVIAVLGAVLAYQGGRLVAVGGSWYYLIAGI
ALFLAGVLLALGRRAGLWLFGATLAGTIAWALWEVGLDGWGLVPRLAMIS
VLGLVLLPFWGVARRRMQPLSGLSYALVTGVLPILGAALILWPLLMPRNV
ELADASELPADSATAFSRGTVPSPDGNVAANHDASNWTSYAGSNLSNHYT
PGAQITPDNVKNLKVAWEFHTGDLKPKDSKLGYAFQNTPLKVGDLLYICT
PTQKVIAVEAANGKERWRFDPQTNPKAMAGVAATTCRGVSYYQAPEGTAE
CPTRIFWPMVDGRLGALDAQTGKLCTSFGNNGYVDLNAGTGNTKPGFVGP
TSPPVVMRGVVIQPTGQVRDGQEGDAPSGVVRGFDALTGQLRWAWDLGNP
AITAEPPAGQTYTRSTPNVWSLMAADDELGLVYLPTGNASGDFFGKGRTP
QDEEYTASLVAVDAATGKERWHFRTVNHDLWDYDIGPQPNLVDWPVAGGG
TRAAVIQATKSGQVFVLDRATGEPIMPVKQIPVPQGTDHGDWTAATQPIS
PGMPNTVGAPSREFEKIIESDAWGMTPFDQLVCRIQFKQLRYEGMFTPPT
LQGSLAFTGNHGGINWGGVSVDLQRGIMVMNSNRLPYTLQVYTRQKMDEL
GVVSVFDGKSKTPGYMARKGLAYGARKEPWMSPLNTPCVAPPWGYIAGVD
LRTQQVIWRRPLGTGYDQGPMGIPSKTKFEIGTPNNSGSLATAGGVTFIG
ATLDDFMRGFDTRTGKQVWETRVPAGPQAAPMSYTINGKQYIVAAVGGHD
RMETKSGDSVIAWALPDDAQAAPAK
XFF4834R

XFF4834R_chr28740 lcl|XFF4834R_chr31310982_3311501_r2_XFF4834R-XFF4834R_chr28740

36

820

S=1413 I=41 E=2.79069e-164

XFF4834R

XFF4834R_chr06570 lcl|XFF4834R_chr06830099_0750129_f1_XFF4834R-XFF4834R_chr06570

723

797

S=148 I=43 E=6.29745e-11

XFF4834R

XFF4834R_chr06570 lcl|XFF4834R_chr06830099_0750129_f1_XFF4834R-XFF4834R_chr06570

171

323

S=137 I=31 E=1.24208e-09

XFF4834R

XFF4834R_chr06570 lcl|XFF4834R_chr06830099_0750129_f1_XFF4834R-XFF4834R_chr06570

397

532

S=122 I=29 E=8.15966e-08

X.species

NP_643520.1 lcl|gcd-XAC3212

1

825

S=4056 I=94 E=0

glucose dehydrogenase

X.species

YP_365068.1 lcl|gcd2-XCV3337

1

825

S=4049 I=94 E=0

glucose dehydrogenase

X.species

NP_638430.1 lcl|gcd-XCC3083

1

822

S=3832 I=88 E=0

glucose dehydrogenase

X.species

YP_363404.1 lcl|gcd1-XCV1673

36

820

S=1440 I=42 E=5.34847e-167

glucose dehydrogenase

X.species

NP_636946.1 lcl|gcd-XCC1575

36

816

S=1410 I=40 E=2.39012e-163

glucose dehydrogenase

X.species

NP_641965.1 lcl|gcd-XAC1633

186

820

S=1378 I=45 E=1.93238e-159

glucose dehydrogenase

X.species

NP_641001.1 lcl|mxaF-XAC0648

723

797

S=148 I=43 E=2.27515e-10

methanol dehydrogenase heavy chain

X.species

NP_641001.1 lcl|mxaF-XAC0648

171

323

S=137 I=31 E=4.29597e-09

methanol dehydrogenase heavy chain

X.species

NP_641001.1 lcl|mxaF-XAC0648

397

532

S=117 I=29 E=1.09971e-06

methanol dehydrogenase heavy chain

X.species

YP_362440.1 lcl|mxaF-XCV0709

737

797

S=139 I=46 E=2.92722e-09

methanol dehydrogenase heavy chain (fragment)

X.species

YP_362439.1 lcl|mxaF-XCV0708

175

323

S=136 I=31 E=6.70152e-09

methanol dehydrogenase heavy chain (fragment)

X.species

YP_362439.1 lcl|mxaF-XCV0708

397

532

S=118 I=29 E=8.76657e-07

methanol dehydrogenase heavy chain (fragment)

X.species

NP_638828.1 lcl|mxaF-XCC3482

171

323

S=134 I=30 E=1.22304e-08

methanol dehydrogenase heavy chain

X.species

NP_638828.1 lcl|mxaF-XCC3482

397

532

S=110 I=27 E=8.38561e-06

methanol dehydrogenase heavy chain

X.species

NP_638828.1 lcl|mxaF-XCC3482

723

775

S=102 I=44 E=7.41585e-05

methanol dehydrogenase heavy chain

pubmed

33

820

S=1418 I=40 E=1.07491e-162

Quinoprotein glucose dehydrogenase EC=1.1.5.2 ; Cell inner membrane Oxidoreductase PQQ Transmembrane

Pubmed 2228962,8419307

 

prodomImg

pubmed

35

817

S=1414 I=41 E=3.2813e-162

Putative glucose dehydrogenase

Pubmed 19376896

 

prodomImg

pubmed

33

816

S=1363 I=39 E=5.18269e-156

Glucose dehydrogenase

Pubmed 10376838

 

prodomImg

pubmed

36

818

S=1312 I=38 E=9.41126e-150

Quinoprotein glucose dehydrogenase A EC=1.1.5.2 ; Cell inner membrane Oxidoreductase PQQ Signal Transmembrane

Pubmed 3399393

 

prodomImg

pubmed

154

817

S=1264 I=41 E=6.10848e-144

Glycerol dehydrogenase large subunit EC=1.1.99.22 ; Oxidoreductase Secreted Signal

Pubmed 12686146,12676670

 

prodomImg

sp

33

820

S=1418 I=40 E=7.31997e-163

Quinoprotein glucose dehydrogenase EC=1.1.5.2 ; Cell inner membrane Oxidoreductase PQQ Transmembrane

 

prodomImg

sp

36

818

S=1312 I=38 E=6.4089e-150

Quinoprotein glucose dehydrogenase A EC=1.1.5.2 ; Cell inner membrane Oxidoreductase PQQ Signal Transmembrane

 

prodomImg

sp

154

817

S=1264 I=41 E=4.15976e-144

Glycerol dehydrogenase large subunit EC=1.1.99.22 ; Oxidoreductase Secreted Signal

 

prodomImg

sp

179

817

S=1252 I=43 E=1.11322e-142

Glycerol dehydrogenase large subunit EC=1.1.99.22 ; Oxidoreductase Secreted Signal

 

prodomImg

sp

33

817

S=1236 I=37 E=9.17387e-141

Quinoprotein glucose dehydrogenase EC=1.1.5.2 ; Cell inner membrane Oxidoreductase PQQ Signal Transmembrane

 

prodomImg

Iprscan IPR011047 [G3DSA:2.140.10.10]

172

815

Quinonprotein alcohol dehydrogenase-like

Iprscan IPR002372 [PF01011]

245

277

Pyrrolo-quinoline quinone repeat

Iprscan IPR002372 [PF01011]

458

484

Pyrrolo-quinoline quinone repeat

Iprscan IPR002372 [PF01011]

746

782

Pyrrolo-quinoline quinone repeat

Iprscan IPR019551 [PF10527]

183

225

PQQ-dependent enzyme, N-terminal

Iprscan IPR019556 [PF10535]

420

440

PQQ-dependent enzyme, C-terminal

Iprscan IPR018391 [SM00564]

239

270

Pyrrolo-quinoline quinone beta-propeller repeat

Iprscan IPR018391 [SM00564]

353

396

Pyrrolo-quinoline quinone beta-propeller repeat

Iprscan IPR018391 [SM00564]

424

474

Pyrrolo-quinoline quinone beta-propeller repeat

Iprscan IPR018391 [SM00564]

496

529

Pyrrolo-quinoline quinone beta-propeller repeat

Iprscan IPR018391 [SM00564]

739

772

Pyrrolo-quinoline quinone beta-propeller repeat

Iprscan IPR017511 [TIGR03074]

16

816

PQQ-dependent membrane bound dehydrogenase, glucose/quinate/shikimate related

Iprscan [seg]

14

30

-

Iprscan [seg]

46

72

-

Iprscan [SignalP-NN(euk)]

1

30

-

Iprscan [tmhmm]

9

31

-

Iprscan [tmhmm]

36

58

-

Iprscan [tmhmm]

65

87

-

Iprscan [tmhmm]

91

113

-

Iprscan [tmhmm]

120

142

-

PD601080

80

174

S=419 I=87 E=4.11781e-43

PD003220

388

537

S=302 I=46 E=5.92119e-29

PD703840

527

644

S=253 I=53 E=4.65583e-23

PD014146

295

386

S=219 I=54 E=6.81009e-19

PDA216K1

649

680

S=161 I=97 E=6.42532e-12

PDA8Q5T3

367

418

S=136 I=48 E=8.04e-09

PD858570

681

734

S=135 I=48 E=9.74001e-09

PDA1J501

388

417

S=132 I=80 E=2.41188e-08

PD014147

732

774

S=123 I=51 E=2.72273e-07

PDA4D5L3

732

774

S=114 I=47 E=2.91698e-06

Iprscan IPR011047 [SSF50998]

178

817

Quinonprotein alcohol dehydrogenase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gFJIvCqy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

73 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

21 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrT05LE/XFF4834R_chr14150.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrT05LE/XFF4834R_chr14150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrT05LE/XFF4834R_chr14150.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrT05LE/XFF4834R_chr14150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.