Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr14010pilRXFF4834R_chr14010two-component system response regulator protein PilR

pilR XFF4834R_chr14010
XFF4834R_chr_1506
XFF4834R_chr_1506
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14020
XFF4834R_chr14020
ID pilR
AC XFF4834R_chr14010
LT XFF4834R_chr14010
OR XFF4834R_chr from 1602204 to 1603658 on strand -
DE two-component system response regulator protein PilR
IP ATPase, AAA+ type, core; CheY-like; Signal transduction response regulator, PEP-CTERM system, putative
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
Cellular Component: intracellular (GO:0005622)
DNA-dependent (GO:0006355)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: transcription factor binding (GO:0008134)
Molecular Function: two-component response regulator activity (GO:0000156)

Curated
PM
AN functional study of the ortholog in Xac
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110317)
MW 52479.6 Da
SQ 484 aa
 
........10........20........30........40........50
| | | | |
LGRHLLDNCRPSSRWAIVRPMNEPKSALVVDDERDIRELLVLTLGRMGLR
ISTAANLAEARELLANNPYDLCLTDMRLPDGNGIELVTEIAKHYPQTPVA
MITAFGSMDLAVEALKAGAFDFVSKPVDIGVLRGLVKHALELNNRDRPAP
PPPPPEQASRLLGDSSAMESLRATISKVARSQAPVYIVGESGVGKELVAR
TIHEQGARAAGPFVPVNCGAIPAELMESEFFGHKKGSFTGAHADKPGLFQ
AAHGGTLFLDEVAELPLQMQVKLLRAIQEKSVRPVGASSESLVDVRILSA
THKDLGDLVSDGRFRHDLYYRINVIELRVPPLRERGGDLPQLAAAIIARL
AHSHGRPIPLLTQSALDALNHYGFPGNVRELENILERALALAEDDQISAT
DLRLPAHGGHRLAAPPGGAAAEPREAVVDIDPASAALPSYIEQLERAAIQ
KALEENRWNKTKTAAQLGITFRALRYKLKKLGME
XFF4834R

XFF4834R_chr01970 XFF4834R_chr02090240_0235586_f3_XFF4834R-XFF4834R_chr01970

28

483

S=707 I=38 E=5.42541e-79

XFF4834R

XFF4834R_chr01760 glnG-XFF4834R_chr01760

29

402

S=687 I=40 E=1.62482e-76

fused DNA-binding response regulator in two-component regulatory system with GlnL: response regulator/sigma54 interaction protein

XFF4834R

XFF4834R_chr35390 XFF4834R_chr38610176_4112519_f3_XFF4834R-XFF4834R_chr35390

69

404

S=568 I=40 E=4.22699e-62

XFF4834R

XFF4834R_chr08510 XFF4834R_chr09090313_0988386_r1_XFF4834R-XFF4834R_chr08510

169

482

S=561 I=41 E=3.2232e-61

XFF4834R

XFF4834R_chr36240 XFF4834R_chr39420397_4198758_r1_XFF4834R-XFF4834R_chr36240

70

478

S=530 I=35 E=1.79118e-57

XFF4834R

XFF4834R_chr06630 XFF4834R_chr06920268_0759253_r3_XFF4834R-XFF4834R_chr06630

177

484

S=499 I=38 E=1.04885e-53

XFF4834R

XFF4834R_chr11300 prpR-XFF4834R_chr11300

161

387

S=469 I=45 E=3.97155e-50

DNA-binding transcriptional activator

XFF4834R

XFF4834R_chr38900 phoP-XFF4834R_chr38900

28

129

S=131 I=31 E=3.67416e-09

DNA-binding response regulator in two-component regulatory system with PhoQ

XFF4834R

XFF4834R_chr07680 kdpE-XFF4834R_chr07680

24

140

S=130 I=31 E=5.34537e-09

DNA-binding response regulator in two-component regulatory system with KdpD

XFF4834R

XFF4834R_chr18260 XFF4834R_chr_2087428_2088117_r1_XFF4834R-XFF4834R_chr18260

25

126

S=114 I=33 E=4.14423e-07

XFF4834R

XFF4834R_chr32510 XFF4834R_chr_3741015_3741383_r2_XFF4834R-XFF4834R_chr32510

21

137

S=114 I=30 E=4.29131e-07

XFF4834R

XFF4834R_chr20290 cheB-XFF4834R_chr20290

21

145

S=113 I=31 E=5.15354e-07

fused chemotaxis regulator: protein-glutamate methylesterase in two-component regulatory system with CheA

XFF4834R

XFF4834R_chr19260 XFF4834R_chr_2205932_2206498_r3_XFF4834R-XFF4834R_chr19260

21

161

S=111 I=26 E=8.54522e-07

XFF4834R

XFF4834R_chr08400 XFF4834R_chr09010334_0979119_f1_XFF4834R-XFF4834R_chr08400

28

129

S=111 I=30 E=9.91046e-07

XFF4834R

XFF4834R_chr20940 XFF4834R_chr_2423222_2424943_r3_XFF4834R-XFF4834R_chr20940

10

147

S=111 I=26 E=9.99725e-07

XFF4834R

XFF4834R_chr11640 XFF4834R_chr12140295_1300996_f2_XFF4834R-XFF4834R_chr11640

28

129

S=110 I=27 E=1.42931e-06

XFF4834R

XFF4834R_chr28410 XFF4834R_chr30950853_3272272_f2_XFF4834R-XFF4834R_chr28410

13

140

S=108 I=28 E=2.21031e-06

XFF4834R

XFF4834R_chr20160 XFF4834R_chr_2312560_2313696_f1_XFF4834R-XFF4834R_chr20160

70

181

S=107 I=27 E=2.63137e-06

XFF4834R

XFF4834R_chr20500 XFF4834R_chr_2371769_2372134_r3_XFF4834R-XFF4834R_chr20500

28

140

S=106 I=26 E=3.66496e-06

X.species

YP_365082.1 pilR-XCV3351

1

484

S=2187 I=90 E=0

two-component system response regulator PilR

X.species

NP_643546.1 pilR-XAC3238

1

484

S=2182 I=90 E=0

two-component system regulatory protein

X.species

NP_638443.1 pilR-XCC3096

18

484

S=2019 I=87 E=0

two-component system regulatory protein

X.species

XALc_0668 pilR-XALc_0668

21

484

S=1776 I=79 E=0

probable two-component system response regulator protein pilr

X.species

XALc_2598 XALc_2598

28

484

S=695 I=39 E=6.88581e-77

probable two component system regulatory protein, sigma 54-dependent

X.species

NP_635584.1 ntrC-XCC0189

29

402

S=692 I=40 E=1.52239e-76

two-component system regulatory protein

X.species

NP_640582.1 ntrC-XAC0226

28

483

S=691 I=38 E=1.66109e-76

two-component system regulatory protein

X.species

XALc_3089 ntrC-XALc_3089

29

402

S=685 I=41 E=9.33512e-76

probable two-component regulatory system regulatory ntrc transcription regulator protein

X.species

NP_640564.1 ntrC-XAC0208

29

402

S=685 I=40 E=9.58251e-76

two-component system regulatory protein

X.species

YP_361923.1 ntrC-XCV0192

29

402

S=683 I=40 E=1.68889e-75

two-component system regulatory protein

X.species

YP_361963.1 XCV0232

28

483

S=677 I=38 E=8.47434e-75

sigma 54-dependent response regulator

X.species

NP_637938.1 pilR-XCC2590

28

379

S=621 I=38 E=5.69081e-68

two-component system regulatory protein

X.species

XALc_1409 fleQ-XALc_1409

163

402

S=592 I=49 E=2.06295e-64

probable flagellar sigma-54 dependent transcriptional activator fleq protein

X.species

NP_642293.1 fleQ-XAC1967

156

402

S=576 I=48 E=1.51787e-62

transcriptional regulator

X.species

YP_363745.1 fleQ-XCV2014

156

402

S=576 I=48 E=1.7758e-62

flagellar sigma-54 dependent transcriptional activator FleQ

X.species

NP_643950.1 styS-XAC3643

69

404

S=571 I=41 E=6.17822e-62

histidine kinase-response regulator hybrid protein

X.species

NP_635955.1 ntrC-XCC0563

69

404

S=570 I=41 E=7.68291e-62

histidine kinase/response regulator hybrid protein

X.species

NP_637298.1 fleQ-XCC1933

163

402

S=569 I=48 E=1.05157e-61

transcriptional regulator

X.species

YP_365491.1 XCV3760

69

404

S=565 I=40 E=3.82158e-61

two-component system regulatory protein

X.species

NP_641197.1 flbD-XAC0845

169

482

S=558 I=41 E=2.30283e-60

transcriptional regulator

pubmed

21

484

S=2107 I=89 E=0

Response regulator ; ATP-binding DNA-binding Nucleotide-binding Transcription regulation

Pubmed 15057449

 

prodomImg

pubmed

25

484

S=1326 I=60 E=1.02243e-151

Type 4 fimbriae expression regulatory protein pilR ; Activator ATP-binding Cytoplasm DNA-binding Nucleotide-binding Phosphoprotein Transcriptio

Pubmed 1317379,8097014

 

prodomImg

pubmed

25

484

S=1318 I=60 E=8.28694e-151

PilR ; ATP-binding DNA-binding Nucleotide-binding Transcription regulation

Pubmed 14983043

 

prodomImg

pubmed

13

402

S=946 I=53 E=1.06421e-105

PehR ; ATP-binding DNA-binding Nucleotide-binding Transcription regulation

Pubmed 9390420

 

prodomImg

pubmed

28

483

S=837 I=41 E=1.83929e-92

Jer4 ; ATP-binding DNA-binding Nucleotide-binding Transcription regulation

Pubmed 17185223

 

prodomImg

sp

25

484

S=1326 I=60 E=6.95711e-152

Type 4 fimbriae expression regulatory protein pilR ; Activator ATP-binding Cytoplasm DNA-binding Nucleotide-binding Phosphoprotein Transcriptio

 

prodomImg

sp

28

484

S=796 I=38 E=1.12252e-87

Acetoacetate metabolism regulatory protein AtoC ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding Phosphoprotein Repressor Transcription re

 

prodomImg

sp

28

480

S=781 I=41 E=7.77027e-86

Transcriptional regulatory protein zraR ; Activator ATP-binding Cytoplasm DNA-binding Nucleotide-binding Phosphoprotein regulation Two-component system

 

prodomImg

sp

28

480

S=759 I=40 E=3.32703e-83

Transcriptional regulatory protein zraR ; Activator ATP-binding Cytoplasm DNA-binding Nucleotide-binding Phosphoprotein regulation Two-component

 

prodomImg

sp

28

480

S=753 I=40 E=1.65491e-82

Transcriptional regulatory protein zraR ; Activator ATP-binding Cytoplasm DNA-binding Nucleotide-binding Phosphoprotein regulation Two-componen

 

prodomImg

Iprscan IPR020441 [PR01590]

447

464

Helix-turn-helix, Fis

Iprscan IPR020441 [PR01590]

464

484

Helix-turn-helix, Fis

Iprscan [G3DSA:3.40.50.2300]

22

142

-

Iprscan [G3DSA:3.40.50.300]

159

333

-

Iprscan [G3DSA:1.10.8.60]

334

409

-

Iprscan [PTHR23283:SF47]

10

145

-

Iprscan [PTHR23283]

10

145

-

Iprscan IPR002078 [PF00158]

162

327

RNA polymerase sigma factor 54, interaction

Iprscan IPR001789 [PF00072]

28

133

Signal transduction response regulator, receiver domain

Iprscan IPR002197 [PF02954]

441

481

Helix-turn-helix, Fis-type

Iprscan IPR001789 [SM00448]

25

136

Signal transduction response regulator, receiver domain

Iprscan IPR003593 [SM00382]

181

324

ATPase, AAA+ type, core

Iprscan IPR002078 [PS00675]

185

198

RNA polymerase sigma factor 54, interaction

Iprscan IPR002078 [PS00676]

247

262

RNA polymerase sigma factor 54, interaction

Iprscan IPR002078 [PS00688]

374

383

RNA polymerase sigma factor 54, interaction

Iprscan IPR002078 [PS50045]

161

390

RNA polymerase sigma factor 54, interaction

Iprscan IPR001789 [PS50110]

26

140

Signal transduction response regulator, receiver domain

Iprscan [seg]

54

67

-

Iprscan [seg]

148

155

-

Iprscan [seg]

405

426

-

PD420887

269

351

S=217 I=51 E=9.02739e-19

PDA9U4H3

182

385

S=206 I=30 E=2.25311e-17

PDA06189

173

342

S=201 I=28 E=7.9075e-17

PDA1J921

343

377

S=176 I=97 E=9.22802e-14

PD082887

161

273

S=168 I=37 E=7.61102e-13

PD580175

221

270

S=156 I=57 E=2.44609e-11

PDA2V894

1

27

S=150 I=96 E=1.4111e-10

PDA7S709

160

218

S=131 I=44 E=2.35634e-08

PD569604

316

402

S=122 I=38 E=3.67271e-07

PD596848

187

262

S=119 I=35 E=7.77367e-07

Iprscan [SSF52540]

160

403

-

Iprscan IPR011006 [SSF52172]

22

206

CheY-like

Iprscan IPR009057 [SSF46689]

374

484

Homeodomain-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OtIGHI1g)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

228 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

28 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

23 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbxvFRe/XFF4834R_chr14010.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbxvFRe/XFF4834R_chr14010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbxvFRe/XFF4834R_chr14010.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbxvFRe/XFF4834R_chr14010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.