Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr14000pilBXFF4834R_chr14000probable Type IV pilus assembly protein PilB

pilB XFF4834R_chr14000
XFF4834R_chr14000
XFF4834R_chr14000
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_1506
XFF4834R_chr_1506
ID pilB
AC XFF4834R_chr14000
LT XFF4834R_chr14000
OR XFF4834R_chr from 1600018 to 1601754 on strand +
DE probable Type IV pilus assembly protein PilB
IP Type II secretion system protein E; General secretory system II, protein E, N-terminal
CL 1.6.13 Fimbria, pili, curli GO:0009297
EC
GO InterPro
Biological Process: transport (GO:0006810)
Biological Process: pilus assembly (GO:0009297)
Cellular Component: intracellular (GO:0005622)
Molecular Function: protein transporter activity (GO:0008565)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110317)
MW 62578.1 Da
SQ 578 aa
 
........10........20........30........40........50
| | | | |
MSVLSTANLVGITGIARRLVQDGALEESAARSAMDQAALAKVPLPQWFSE
KKLVAASQLAAANAVEFGMPLLDVSAFDASQNAVKLVSEELLQKHQVLPL
FKRGNRLFVGVSNPTQTRALDDIKFHTNLVVEAILVDEDQIRRTLEQWQA
SNASLGSSLGNDDEEMGDLDVSAGDEDMGAGGDSGVDAKGDDTPVVKFVN
KVLVDAIRRGASDIHFEPYEDDYRVRLRIDGLLKNVAKAPVKLNQRIAAR
LKVMSQLDIAEKRVPQDGRIKLNLSKTKQIDFRVSTLPTLFGEKVVLRIL
DGSAAKLGIDKLGYEADQQKLFLEAIHKPYGMVLVTGPTGSGKTVSLYTA
LGILNDETRNISTAEDPVEIRLPGVNQVQQNNKRGMTFAAALRSFLRQDP
DIIMVGEIRDLETAEIAIKAAQTGHMVLSTLHTNDAPQTIARLMNMGIAP
YNITSSVTLVIAQRLARRLCNNCKRKSTLPDNALLAEGFTPAQLAAGIEL
YEAVGCDECTEGYKGRTGIYQVMPMTDEIGAIVLEGGNAMQIAEAAQAIG
IRDLRQSALMKAAHGVTSLAEINRVTKD
XFF4834R

XFF4834R_chr40840 lcl|XFF4834R_chr_4728446_4730260_f2_XFF4834R-XFF4834R_chr40840

86

572

S=896 I=39 E=9.23956e-102

XFF4834R

XFF4834R_chr07050 lcl|gspE-XFF4834R_chr07050

191

577

S=892 I=47 E=2.72382e-101

general secretory pathway component, cryptic

XFF4834R

XFF4834R_chr34380 lcl|XFF4834R_chr37340472_3974199_r1_XFF4834R-XFF4834R_chr34380

67

578

S=866 I=39 E=3.56018e-98

XFF4834R

XFF4834R_chr17150 lcl|XFF4834R_chr18310812_1964849_f3_XFF4834R-XFF4834R_chr17150

199

469

S=286 I=32 E=7.23264e-28

predicted transporter

XFF4834R

XFF4834R_chr35010 lcl|XFF4834R_chr_4063490_4064623_f2_XFF4834R-XFF4834R_chr35010

315

467

S=247 I=40 E=3.49304e-23

XFF4834R

XFF4834R_chr17160 lcl|XFF4834R_chr18320962_1966092_f1_XFF4834R-XFF4834R_chr17160

331

446

S=210 I=39 E=1.2007e-18

XFF4834R

XFF4834R_chr_1506 lcl|XFF4834R_chr14870893_1601997_f1_acur-XFF4834R_chr_1506

554

578

S=101 I=80 E=1.68338e-05

XFF4834R

XFF4834R_chr26490 lcl|XFF4834R_chr_3060268_3061326_r1_XFF4834R-XFF4834R_chr26490

333

467

S=99 I=28 E=3.07221e-05

X.species

YP_365083.1 lcl|pilB-XCV3352

1

578

S=2934 I=96 E=0

Tfp pilus assembly pathway ATPase PilB

X.species

NP_643547.1 lcl|pilB-XAC3239

1

578

S=2904 I=95 E=0

pilus biogenesis protein

X.species

NP_638444.1 lcl|pilB-XCC3097

1

578

S=2797 I=94 E=0

pilus biogenesis protein

X.species

lcl|pilB-XALc_0667

1

578

S=2525 I=85 E=0

probable tfp pilus assembly pathway atpase pilb protein

X.species

lcl|gspE-XALc_0077

88

572

S=906 I=40 E=1.82529e-102

probable general secretory system II, protein e

X.species

NP_641049.1 lcl|xcsE-XAC0696

191

577

S=898 I=48 E=1.97264e-101

type II secretion system protein E

X.species

NP_639427.1 lcl|gspE-XCC4088

86

572

S=892 I=39 E=9.23123e-101

general secretory pathway related protein

X.species

NP_644511.1 lcl|gspE-XAC4212

86

572

S=892 I=39 E=1.04297e-100

general secretory pathway related protein

X.species

YP_366043.1 lcl|XCV4312

86

572

S=891 I=38 E=1.27456e-100

type II secretory pathway ATPase

X.species

NP_638770.1 lcl|xcsE-XCC3424

191

577

S=881 I=47 E=2.47043e-99

type II secretion system protein E

pubmed

27

578

S=1588 I=54 E=0

Type IV pilus assembly protein tapB ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

Pubmed 8820654

 

prodomImg

pubmed

10

578

S=1579 I=55 E=0

PilB protein

Pubmed 10735861

 

prodomImg

pubmed

10

578

S=1578 I=54 E=0

Type 4 fimbrial assembly protein pilB ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

Pubmed 1971619

 

prodomImg

pubmed

27

578

S=1573 I=54 E=0

TapB Type IV pilus assembly protein TapB

Pubmed 18212071

 

prodomImg

pubmed

12

578

S=1474 I=50 E=1.28626e-169

Pilus assembly protein PilB

Pubmed 9529113

 

prodomImg

pubmed

14

578

S=1410 I=50 E=7.70564e-162

PilF ; ATP-binding Nucleotide-binding

Pubmed 18757541

 

prodomImg

pubmed

67

578

S=1388 I=54 E=3.32825e-159

FimN

Pubmed 7642131

 

prodomImg

pubmed

14

578

S=1380 I=48 E=3.29661e-158

Type IV pilus assembly protein pilF ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

Pubmed 8100347

 

prodomImg

pubmed

67

575

S=1336 I=52 E=6.76914e-153

Type IV-A pilus assembly protein PilB

Pubmed 10024587

 

prodomImg

pubmed

67

575

S=1328 I=51 E=5.88284e-152

PilB

Pubmed 18523167

 

prodomImg

sp

27

578

S=1588 I=54 E=0

Type IV pilus assembly protein tapB ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

 

prodomImg

sp

10

578

S=1578 I=54 E=0

Type 4 fimbrial assembly protein pilB ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

 

prodomImg

sp

14

578

S=1380 I=48 E=2.26807e-158

Type IV pilus assembly protein pilF ; ATP-binding Cytoplasm Fimbrium Nucleotide-binding Transport

 

prodomImg

sp

191

578

S=919 I=48 E=1.63749e-102

General secretion pathway protein E ; ATP-binding Cytoplasm Nucleotide-binding Transport

 

prodomImg

sp

164

578

S=902 I=45 E=1.81506e-100

General secretion pathway protein E ; ATP-binding Cytoplasm Nucleotide-binding Transport

 

prodomImg

PD582209

211

320

S=356 I=60 E=1.27058e-35

PD000739

322

403

S=199 I=52 E=1.45038e-16

PD002760

402

474

S=180 I=54 E=2.61962e-14

PD293614

86

154

S=180 I=46 E=2.93401e-14

PD464867

10

78

S=167 I=49 E=1.27944e-12

PD642137

331

443

S=160 I=31 E=7.91404e-12

PD471883

453

529

S=160 I=41 E=8.41209e-12

PDA054J5

334

481

S=142 I=32 E=1.23249e-09

PDA253N0

307

330

S=128 I=96 E=6.45443e-08

PDA1T0T1

307

330

S=124 I=92 E=1.93623e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Jaiz6T02)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

204 hits
swiss-prot

Swiss-Prot ncbi-blastp

26 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

9 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9767nF/XFF4834R_chr14000.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9767nF/XFF4834R_chr14000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9767nF/XFF4834R_chr14000.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9767nF/XFF4834R_chr14000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.