Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13970pilCXFF4834R_chr13970fimbrial assembly protein

pilC XFF4834R_chr13970
XFF4834R_chr13960
XFF4834R_chr13960
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13980
XFF4834R_chr13980
ID pilC
AC XFF4834R_chr13970
LT XFF4834R_chr13970
OR XFF4834R_chr from 1597422 to 1598678 on strand -
DE fimbrial assembly protein
IP Type II secretion system conserved site
CL 1.6.13 Fimbria, pili, curli GO:0009297
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)
Cellular Component: membrane (GO:0016020)

Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100504)
MW 45939.1 Da
SQ 418 aa
 
........10........20........30........40........50
| | | | |
MSVARSSIKKQPVDRNVSEMIPFVWEGTDKRGVKMKGEQQARNANMLRAE
LRRQGITPTVVKTKPKPLFGAAGKKISPKDIAFFSRQMATMMKSGVPIVG
ALEIIGEGHKNPRMKKMVGQIRADIEGGSSLYEAISRHPVQFDDLYRNLV
RAGEGAGVLETVLDTVANYKENIEALKGKIKKALFYPAMVMAVAIIVSGI
LLVFVVPQFEDVFKGFGAELPAFTQMIVAASRFMVSYWWFMLLASVAAIA
GFIFAYKRSPRMRHGMDRLVLKFPVIGQIMHNSSIARFARTTAVTFKAGV
PLVEALSIVAGATGNKVYEEAVLRMRDDVSVGYPVNMAMKQVNLFPHMVI
QMTSIGEEAGALDAMLFKVAEYFEQEVNNAVDALSSLLEPLIMVFIGTIV
GGMVIGMYLPIFKLGSVV
XFF4834R

XFF4834R_chr34370 lcl|XFF4834R_chr37330079_3972296_r2_XFF4834R-XFF4834R_chr34370

23

418

S=505 I=29 E=1.51362e-54

XFF4834R

XFF4834R_chr07060 lcl|gspF-XFF4834R_chr07060

20

417

S=425 I=31 E=7.47258e-45

general secretory pathway component, cryptic

XFF4834R

XFF4834R_chr34370 lcl|XFF4834R_chr37330079_3972296_r2_XFF4834R-XFF4834R_chr34370

23

418

S=505 I=29 E=1.51362e-54

XFF4834R

XFF4834R_chr07060 lcl|gspF-XFF4834R_chr07060

20

417

S=425 I=31 E=7.47258e-45

general secretory pathway component, cryptic

X.species

NP_638447.1 lcl|pilC-XCC3100

1

418

S=2025 I=92 E=0

fimbrial assembly protein

X.species

YP_365085.1 lcl|pilC-XCV3354

1

418

S=1860 I=84 E=0

fimbrial assembly protein

X.species

lcl|pilC-XALc_0665

2

418

S=1824 I=82 E=0

probable fimbrial assembly protein

X.species

NP_643550.2 lcl|pilC-XAC3242

20

418

S=1773 I=84 E=0

fimbrial assembly protein

X.species

NP_636053.1 lcl|xpsF-XCC0661

23

418

S=510 I=30 E=1.52521e-54

general secretion pathway protein F

X.species

YP_365398.1 lcl|xpsF-XCV3667

23

418

S=505 I=30 E=5.39974e-54

type II secretory pathway component

X.species

NP_643850.1 lcl|xpsF-XAC3543

84

418

S=505 I=31 E=5.89166e-54

general secretion pathway protein F

X.species

NP_643850.1 lcl|xpsF-XAC3543

281

375

S=119 I=30 E=3.66325e-07

general secretion pathway protein F

X.species

lcl|xpsF-XALc_2663

23

418

S=504 I=31 E=7.92463e-54

probable general secretion pathway protein f

X.species

NP_638769.1 lcl|xcsF-XCC3423

75

417

S=458 I=33 E=2.96971e-48

type II secretion system protein F

X.species

NP_641050.1 lcl|xcsF-XAC0697

19

417

S=436 I=31 E=1.28269e-45

type II secretion system protein F

X.species

YP_362489.1 lcl|xcsF-XCV0758

75

417

S=433 I=32 E=3.17628e-45

type II secretion system protein F

X.species

YP_361574.1 lcl|pilR-XCVd0015

148

332

S=100 I=29 E=6.67437e-05

putative PilR-like integral membrane protein

pubmed

23

418

S=1089 I=51 E=3.55797e-123

Type IV pilus assembly protein tapC ; Cell inner membrane Fimbrium Transmembrane Transport

Pubmed 8820654

 

prodomImg

pubmed

46

418

S=1019 I=52 E=1.16695e-114

Type 4 fimbrial assembly protein pilC ; Cell inner membrane Fimbrium Transmembrane Transport

Pubmed 1971619

 

prodomImg

pubmed

23

418

S=1004 I=50 E=7.59956e-113

PilC protein

Pubmed 10735861

 

prodomImg

pubmed

13

418

S=984 I=49 E=1.79857e-110

Pilus assembly protein PilC ; Transmembrane Transport

Pubmed 9529113

 

prodomImg

pubmed

23

389

S=888 I=50 E=9.25949e-99

Pilin biogenesis protein ; Transmembrane Transport

Pubmed 11807055

 

prodomImg

pubmed

19

346

S=882 I=48 E=4.48688e-98

Truncated type IV pilus assembly protein TapC ; Transmembrane Transport

Pubmed 12240967

 

prodomImg

pubmed

19

346

S=882 I=48 E=4.48688e-98

Truncated TapC ; Transmembrane Transport

Pubmed 18212071

 

prodomImg

pubmed

23

418

S=852 I=44 E=2.18776e-94

PilG ; Transmembrane Transport

Pubmed 8100347,7565106

 

prodomImg

pubmed

23

418

S=842 I=44 E=2.96596e-93

PilG ; Transmembrane Transport

Pubmed 7565106

 

prodomImg

pubmed

19

417

S=837 I=42 E=1.1259e-92

FimO ; Transmembrane Transport

Pubmed 7642131

 

prodomImg

sp

23

418

S=1089 I=51 E=2.44783e-123

Type IV pilus assembly protein tapC ; Cell inner membrane Fimbrium Transmembrane Transport

 

prodomImg

sp

46

418

S=1019 I=52 E=8.02845e-115

Type 4 fimbrial assembly protein pilC ; Cell inner membrane Fimbrium Transmembrane Transport

 

prodomImg

sp

23

418

S=754 I=40 E=8.75489e-83

Type IV pilin assembly protein pilC ; Cell inner membrane Fimbrium Transmembrane Transport

 

prodomImg

sp

23

418

S=689 I=36 E=7.05461e-75

Type 4 fimbrial assembly protein pilC ; Cell inner membrane Fimbrium Transmembrane Transport

 

prodomImg

sp

20

381

S=531 I=32 E=1.17158e-55

General secretion pathway protein F ; Cell inner membrane Transmembrane Transport

 

prodomImg

PD002882

207

306

S=257 I=49 E=1.35889e-23

PDA07899

84

387

S=163 I=19 E=3.02929e-12

PD336457

23

111

S=154 I=38 E=3.73124e-11

PD550204

75

187

S=153 I=37 E=4.5997e-11

PD550204

280

390

S=141 I=30 E=1.33144e-09

PDA5K2D6

110

231

S=146 I=29 E=3.2427e-10

PD001695

101

163

S=145 I=44 E=4.36162e-10

PD489604

362

418

S=130 I=49 E=2.96699e-08

PDA9L671

74

390

S=123 I=22 E=1.90039e-07

PD811857

307

363

S=118 I=44 E=9.28937e-07

PDA4S382

124

188

S=116 I=35 E=1.51367e-06

PDA4S382

324

390

S=108 I=32 E=1.5124e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one GY4a8AIl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

60 hits
swiss-prot

Swiss-Prot ncbi-blastp

15 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlpQ0Ek/XFF4834R_chr13970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlpQ0Ek/XFF4834R_chr13970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlpQ0Ek/XFF4834R_chr13970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlpQ0Ek/XFF4834R_chr13970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.