Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13960pilDXFF4834R_chr13960type IV pre-pilin peptidase

pilD XFF4834R_chr13960
XFF4834R_chr13950
XFF4834R_chr13950
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13970
XFF4834R_chr13970
ID pilD
AC XFF4834R_chr13960
LT XFF4834R_chr13960
OR XFF4834R_chr from 1596552 to 1597415 on strand -
DE type IV pre-pilin peptidase
IP Peptidase A24A, prepilin type IV; Peptidase A24A, N-terminal
CL 1.6.13 Fimbria, pili, curli GO:0009297
EC
GO InterPro
Cellular Component: membrane (GO:0016020)
Molecular Function: aspartic-type endopeptidase activity (GO:0004190)

Curated
PM
AN
CC COG: [NOU] Cell motility;Posttranslational modification, protein turnover, chaperones;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100504)
MW 31669.3 Da
SQ 287 aa
 
........10........20........30........40........50
| | | | |
MAFLDQHPGLGFPAAAGLGLLIGSFLNVVILRLPKRMEWQWRRDAREILE
LPDIYEPPPPGIVVEPSHDPVTGDKLKWWENIPVLSWVMLRGKSRYSGKP
ISIQYPLVELLTALLCVASVWRFGFGWQGFGAIVLSCFLVAMSGIDLRHK
LLPDQLTLPLMWLGLVGSMDNLYMPAKPALLGAAVGYVSLWTVWWLFKQL
TGKEGMGHGDFKLLAALGAWCGLKGILPIILISSLVGAILGSAWLVAKGR
DRATPIPFGPYLAIAGWVVFFWGNDLVDGYLHFAGLR
X.species

YP_365086.1 lcl|pilD-XCV3355

1

287

S=1343 I=92 E=1.10079e-155

type II secretory pathway prepilin signal peptidase

X.species

NP_643551.1 lcl|pilD-XAC3243

1

287

S=1340 I=92 E=2.47657e-155

type IV pre-pilin leader peptidase

X.species

NP_638448.1 lcl|pilD-XCC3101

1

287

S=1319 I=90 E=8.90719e-153

type IV pre-pilin leader peptidase

X.species

lcl|pilD-XALc_0664

1

287

S=1173 I=79 E=3.93418e-135

probable type II secretory pathway prepilin signal peptidase protein

pubmed

1

287

S=1319 I=90 E=3.30705e-151

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multif

Pubmed 8817497

 

prodomImg

pubmed

27

287

S=546 I=52 E=1.24549e-57

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifu

Pubmed 1971619,1898929

 

prodomImg

pubmed

27

285

S=545 I=45 E=2.06518e-57

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifunctional

Pubmed 7905475

 

prodomImg

pubmed

27

281

S=536 I=48 E=2.11814e-56

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifunctional

Pubmed 8820654

 

prodomImg

pubmed

27

286

S=525 I=43 E=5.01713e-55

PilD ; Hydrolase Protease Transmembrane

Pubmed 18523167

 

prodomImg

pubmed

27

286

S=521 I=43 E=1.39148e-54

PilD ; Hydrolase Protease Transmembrane

Pubmed 18523167

 

prodomImg

pubmed

27

286

S=521 I=43 E=1.39148e-54

PilD ; Hydrolase Protease Transmembrane

Pubmed 18523167

 

prodomImg

pubmed

27

286

S=521 I=43 E=1.51824e-54

Type 4 prepilin peptidase PilD EC=3.4.99.- PilD ; Hydrolase Protease Transmembrane

Pubmed 18523167

 

prodomImg

pubmed

27

283

S=519 I=45 E=2.67586e-54

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifunctional

Pubmed 9826339

 

prodomImg

pubmed

27

286

S=516 I=43 E=6.17972e-54

PilD ; Hydrolase Protease Transmembrane

Pubmed 18523167

 

prodomImg

sp

1

287

S=1319 I=90 E=2.28009e-151

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multif

 

prodomImg

sp

27

286

S=569 I=51 E=1.59875e-60

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifunctional Protease

 

prodomImg

sp

27

287

S=546 I=52 E=8.58718e-58

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifu

 

prodomImg

sp

27

285

S=545 I=45 E=1.42386e-57

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifunctional

 

prodomImg

sp

27

281

S=536 I=48 E=1.46038e-56

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifunctional

 

prodomImg

PD641333

206

283

S=211 I=54 E=4.78865e-18

PDA1L266

35

72

S=187 I=87 E=4.01231e-15

PD002740

72

129

S=170 I=59 E=4.22074e-13

PDA1F8H0

142

206

S=129 I=57 E=3.65587e-08

PD072688

203

250

S=104 I=46 E=4.53488e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one erHWGaHI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

41 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeefwzi/XFF4834R_chr13960.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeefwzi/XFF4834R_chr13960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeefwzi/XFF4834R_chr13960.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeefwzi/XFF4834R_chr13960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.