Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13950coaEXFF4834R_chr13950probable dephospho-CoA kinase

coaE XFF4834R_chr13950
XFF4834R_chr_1499
XFF4834R_chr_1499
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13960
XFF4834R_chr13960
ID coaE
AC XFF4834R_chr13950
LT XFF4834R_chr13950
OR XFF4834R_chr from 1595930 to 1596538 on strand -
DE probable dephospho-CoA kinase
IP Dephospho-CoA kinase
CL 1.5.3.5 Coenzyme A GO:0015937
EC
GO InterPro
Biological Process: coenzyme A biosynthetic process (GO:0015937)
Molecular Function: dephospho-CoA kinase activity (GO:0004140)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 21572.4 Da
SQ 202 aa
 
........10........20........30........40........50
| | | | |
MSDFIVGLTGGIASGKSALAAEFEKLGVPVIDADVVARQVVAPGPILDAI
AAHFGDSVLLPDGTLNRQALRYRVFADTAQRQALEAITHPAIRRELQRAA
LAAQGPYAIVAIPLLAEAGGRATYPWLDRILVVDVPVALQHERLMQRDGA
TAELADRMIAAQATREQRLAIADDVACNHGVLEQLSQVARGLDVDYRARA
NP
X.species

NP_643552.1 lcl|coaE-XAC3244

1

202

S=893 I=87 E=1.896e-101

dephospho-CoA kinase

X.species

YP_365087.1 lcl|coaE-XCV3356

1

201

S=732 I=75 E=7.20869e-82

dephospho-CoA kinase

X.species

NP_638449.1 lcl|coaE-XCC3102

1

198

S=662 I=74 E=1.95165e-73

dephospho-CoA kinase

X.species

lcl|coaE-XALc_0663

1

198

S=496 I=58 E=2.91677e-53

probable dephospho-coa kinase (dephosphocoenzyme a kinase) protein

pubmed

1

198

S=662 I=74 E=6.86405e-72

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 8817497

 

prodomImg

pubmed

4

190

S=402 I=48 E=2.15144e-40

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 8202364

 

prodomImg

pubmed

1

178

S=383 I=49 E=4.62611e-38

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 10735861

 

prodomImg

pubmed

1

178

S=374 I=49 E=5.36073e-37

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 7905475

 

prodomImg

pubmed

4

178

S=369 I=47 E=2.53059e-36

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 10024587

 

prodomImg

pubmed

4

180

S=325 I=43 E=5.19623e-31

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 8820654

 

prodomImg

pubmed

4

178

S=324 I=42 E=6.69109e-31

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 10419967

 

prodomImg

pubmed

5

196

S=303 I=35 E=1.98648e-28

Predicted dephospho-CoA kinase ; ATP-binding Nucleotide-binding

Pubmed 14566056

 

prodomImg

pubmed

5

201

S=303 I=35 E=2.20558e-28

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 10988064

 

prodomImg

pubmed

4

148

S=290 I=42 E=9.45163e-27

Putative dephospho-CoA kinase ; ATP-binding Nucleotide-binding

Pubmed 14742510

 

prodomImg

sp

1

202

S=893 I=87 E=4.61954e-100

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

 

prodomImg

sp

1

201

S=795 I=79 E=3.34143e-88

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

 

prodomImg

sp

1

201

S=795 I=79 E=3.34143e-88

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

 

prodomImg

sp

1

201

S=732 I=75 E=1.75637e-80

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

 

prodomImg

sp

1

198

S=662 I=74 E=4.75513e-72

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

4

192

-

Iprscan [PTHR10695]

77

185

-

Iprscan IPR001977 [PF01121]

5

180

Dephospho-CoA kinase

Iprscan IPR001977 [TIGR00152]

5

194

Dephospho-CoA kinase

Iprscan [seg]

91

104

-

PD003329

30

119

S=170 I=42 E=3.95343e-13

PD582583

117

193

S=137 I=43 E=4.08009e-09

PDA4R4F8

105

196

S=128 I=28 E=5.29544e-08

Iprscan [SSF52540]

4

193

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ecVgxiok)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

26 hits
swiss-prot

Swiss-Prot ncbi-blastp

254 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcgQ1U7/XFF4834R_chr13950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcgQ1U7/XFF4834R_chr13950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcgQ1U7/XFF4834R_chr13950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcgQ1U7/XFF4834R_chr13950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.